| Species : |
Xenopus laevis |
| Source : |
Yeast |
| Tag : |
His |
| Protein Length : |
23-358 aa |
| Description : |
Ligand for mbers of the frizzled family of seven transmbrane receptors. Plays a role in ventral mesodermal patterning during bryogenesis. Mimics Nieuwkoop center activity. Causes dorsal mesodermal differentiation of animal cap ectoderm when coexpressed with noggin and nuclear, sequence-specific DNA-binding protein xBra. None of these molecules causes dorsal mesoderm formation when expressed alone. |
| Form : |
Tris-based buffer,50% glycerol |
| Molecular Mass : |
39.7 kDa |
| AA Sequence : |
AWSVNNFLMTGPKAYLTYSASVAVGAQNGIEECKYQFAWERWNCPESTLQLATHNGLRSATRETSFVHAISSAGVMYTLTRNCSMGDFDNCGCDDSRNGRIGGRGWVWGGCSDNAEFGERISKLFVDGLETGQDARALMNLHNNEAGRLAVKETMKRTCKCHGISGSCSIQTCWLQLAEFRDIGNHLKIKHDQALKLEMDKRKMRSGNSADNRGAIADAFSSVAGSELIFLEDSPDYCLKNISLGLQGTEGRECLQSGKNLSQWERRSCKRLCTDCGLRVEEKKTEIISSCNCKFHWCCTVKCEQCKQVVIKHFCARRERDSNMLNTKRKNRGHRR |
| Purity : |
> 90% as determined by SDS-PAGE. |
| Notes : |
Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : |
A hardcopy of COA with reconstitution instruction is sent along with the products. |
