Recombinant Human PRMT7, His-tagged
Cat.No. : | PRMT7-176H |
Product Overview : | Recombinant Human Protein Arginine N-Methyltransferase 7/PRMT7 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Asp692) of Human PRMT7 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 1-692 a.a. |
Description : | Protein Arginine N-Methyltransferase 7 (PRMT7) belongs to the protein arginine N-methyltransferase family and PRMT7 subfamily. Arginine methyltransferase plays a role in gene imprinting by being recruited by CTCFL at the H19 imprinted control region (ICR) and methylating histone H4 to form H4R3me2s. It may also play a role in embryonic stem cell (ESC) pluripotency and mediate the arginine methylation of histone H2A and myelin basic protein (MBP) in vitro. PRMT7 exists as homodimer and heterodimer. PRMT7 can catalyze the formation of omega-NG-monomethylarginine in peptides. |
AA Sequence : | MKIFCSRANPTTGSVEWLEEDEHYDYHQEIARSSYADMLHDKDRNVKYYQGIRAAVSRVKDRGQK ALVLDIGTGTGLLSMMAVTAGADFCYAIEVFKPMADAAVKIVEKNGFSDKIKVINKHSTEVTVGP EGDMPCRANILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATVYAQLVESGRMWSWNK LFPIHVQTSLGEQVIVPPVDVESCPGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQVSSSA ACHSRRFEPLTSGRAQVVLSWWDIEMDPEGKIKCTMAPFWAHSDPEEMQWRDHWMQCVYFLPQEE PVVQGSALYLVAHHDDYCVWYSLQRTSPEKNERVRQMRPVCDCQAHLLWNRPRFGEINDQDRTDR YVQALRTVLKPDSVCLCVSDGSLLSVLAHHLGVEQVFTVESSAASHKLLRKIFKANHLEDKINII EKRPELLTNEDLQGRKVSLLLGEPFFTTSLLPWHNLYFWYVRTAVDQHLGPGAMVMPQAASLHAV VVEFRDLWRIRSPCGDCEGFDVHIMDDMIKRALDFRESREAEPHPLWEYPCRSLSEPWQILTFDF QQPVPLQPLCAEGTVELRRPGQSHAAVLWMEYHLTPECTLSTGLLEPADPEGGCCWNPHCKQAVY FFSPAPDPRALLGGPRTVSYAVEFHPDTGDIIMEFRHADTPDVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Publications : |
Arginine Methylation of the PGC-1α C-Terminus Is Temperature-Dependent (2022)
|
Gene Name | PRMT7 protein arginine methyltransferase 7 [ Homo sapiens ] |
Official Symbol | PRMT7 |
Synonyms | PRMT7; protein arginine methyltransferase 7; protein arginine N-methyltransferase 7; FLJ10640; KIAA1933; histone-arginine N-methyltransferase PRMT7; myelin basic protein-arginine N-methyltransferase; [Myelin basic protein]-arginine N-methyltransferase PRMT7; |
Gene ID | 54496 |
mRNA Refseq | NM_001184824 |
Protein Refseq | NP_001171753 |
MIM | 610087 |
UniProt ID | Q9NVM4 |
Chromosome Location | 16q22.1 |
Function | S-adenosylmethionine-dependent methyltransferase activity; [myelin basic protein]-arginine N-methyltransferase activity; histone binding; histone methyltransferase activity (H4-R3 specific); histone-arginine N-methyltransferase activity; protein methyltransferase activity; protein-arginine omega-N monomethyltransferase activity; protein-arginine omega-N symmetric methyltransferase activity; protein-arginine omega-N symmetric methyltransferase activity; ribonucleoprotein complex binding; transferase activity; |
◆ Recombinant Proteins | ||
PRMT7-68H | Active Recombinant Human PRMT7, FLAG-tagged | +Inquiry |
PRMT7-13421M | Recombinant Mouse PRMT7 Protein | +Inquiry |
PRMT7-4366R | Recombinant Rat PRMT7 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRMT7-7127M | Recombinant Mouse PRMT7 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRMT7-1365H | Recombinant Human PRMT7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
PRMT7-13HFL | Recombinant Full Length Human PRMT7 Protein, GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRMT7-2838HCL | Recombinant Human PRMT7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRMT7 Products
Required fields are marked with *
My Review for All PRMT7 Products
Required fields are marked with *
0
Inquiry Basket