Recombinant Mouse Stc1 protein, His-GST-tagged
Cat.No. : | Stc1-20M |
Product Overview : | Recombinant Mouse Stc1(Ser28~Ala247) fused with His-GST tag at N-terminal was expressed in E. coli. |
Availability | July 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | GST&His |
Protein Length : | Ser28-Ala247 |
Form : | PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300. |
Molecular Mass : | Predicted Molecular Mass: 54.7 kDa Accurate Molecular Mass: 55 kDa as determined by SDS-PAGE reducing conditions. |
AA Sequence : | SPRKSRVAAQNSAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGITSKVFLAIRRCSTFQEMIAEVQEDCYSKLNVCSIAKRNPEAITEVIQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEGDSPSHIKRTSQESA |
Endotoxin : | <1.0EU per 1µg (determined by the LAL method) |
Purity : | > 97% |
Applications : | SDS-PAGE; WB; ELISA; IP; CoIP; Purification; Amine Reactive Labeling. |
Stability : | The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 centigrade for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition. |
Storage : | Avoid repeated freeze/thaw cycles. Store at 2-8 centigrade for one month. Aliquot and store at -80 centigrade for 12 months. |
Concentration : | 200ug/mL |
Reconstitution : | Reconstitute in 10mM PBS (pH7.4) to a concentration of 0.1-1.0 mg/mL. Do not vortex. |
Publications : |
Stanniocalcin 1 is a phagocytosis checkpoint driving tumor immune resistance (2021)
|
Gene Name | Stc1 stanniocalcin 1 [ Mus musculus ] |
Official Symbol | Stc1 |
Synonyms | STC1; stanniocalcin 1; stanniocalcin-1; STC-1; Stc; |
Gene ID | 20855 |
mRNA Refseq | NM_009285 |
Protein Refseq | NP_033311 |
UniProt ID | O55183 |
◆ Recombinant Proteins | ||
STC1-579H | Recombinant Human STC1 Protein, His-tagged | +Inquiry |
STC1-578H | Recombinant Human STC1 Protein, DDK/His-tagged | +Inquiry |
STC1-5442R | Recombinant Rat STC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
STC1-5783R | Recombinant Rat STC1 Protein | +Inquiry |
STC1-3535H | Recombinant Human STC1 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STC1-1412HCL | Recombinant Human STC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Stc1 Products
Required fields are marked with *
My Review for All Stc1 Products
Required fields are marked with *