Recombinant Human STC1 protein, His-SUMO-tagged
Cat.No. : | STC1-3535H |
Product Overview : | Recombinant Human STC1 protein(P52823)(39-247aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 39-247aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 39.6 kDa |
AA Sequence : | SAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | STC1 stanniocalcin 1 [ Homo sapiens ] |
Official Symbol | STC1 |
Synonyms | STC1; stanniocalcin 1; STC; stanniocalcin-1; |
Gene ID | 6781 |
mRNA Refseq | NM_003155 |
Protein Refseq | NP_003146 |
MIM | 601185 |
UniProt ID | P52823 |
◆ Recombinant Proteins | ||
STC1-4401Z | Recombinant Zebrafish STC1 | +Inquiry |
STC1-6370H | Recombinant Human STC1 Protein (Ser28-Ala247), N-GST tagged | +Inquiry |
STC1-1377H | Recombinant Human STC1 Protein, GST-tagged | +Inquiry |
STC1-3745H | Recombinant Human STC1, Flag-tagged | +Inquiry |
STC1-676H | Recombinant Human STC1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STC1-1412HCL | Recombinant Human STC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STC1 Products
Required fields are marked with *
My Review for All STC1 Products
Required fields are marked with *