Recombinant Human STC1 protein, His-SUMO-tagged
| Cat.No. : | STC1-3535H |
| Product Overview : | Recombinant Human STC1 protein(P52823)(39-247aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 39-247aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 39.6 kDa |
| AA Sequence : | SAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | STC1 stanniocalcin 1 [ Homo sapiens ] |
| Official Symbol | STC1 |
| Synonyms | STC1; stanniocalcin 1; STC; stanniocalcin-1; |
| Gene ID | 6781 |
| mRNA Refseq | NM_003155 |
| Protein Refseq | NP_003146 |
| MIM | 601185 |
| UniProt ID | P52823 |
| ◆ Recombinant Proteins | ||
| STC1-4401Z | Recombinant Zebrafish STC1 | +Inquiry |
| STC1-6370H | Recombinant Human STC1 Protein (Ser28-Ala247), N-GST tagged | +Inquiry |
| STC1-1377H | Recombinant Human STC1 Protein, GST-tagged | +Inquiry |
| STC1-3745H | Recombinant Human STC1, Flag-tagged | +Inquiry |
| STC1-676H | Recombinant Human STC1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| STC1-1412HCL | Recombinant Human STC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STC1 Products
Required fields are marked with *
My Review for All STC1 Products
Required fields are marked with *
