Active Recombinant Full Length Human POT1 Protein, C-Flag-tagged
Cat.No. : | POT1-141HFL |
Product Overview : | Recombinant Full Length Human POT1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is a member of the telombin family and encodes a nuclear protein involved in telomere maintenance. Specifically, this protein functions as a member of a multi-protein complex that binds to the TTAGGG repeats of telomeres, regulating telomere length and protecting chromosome ends from illegitimate recombination, catastrophic chromosome instability, and abnormal chromosome segregation. Increased transcriptional expression of this gene is associated with stomach carcinogenesis and its progression. Alternatively spliced transcript variants have been described. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | EMSA assay Binding assay (competitor) Pull-down assay |
Molecular Mass : | 71.3 kDa |
AA Sequence : | MSLVPATNYIYTPLNQLKGGTIVNVYGVVKFFKPPYLSKGTDYCSVVTIVDQTNVKLTCLLFSGNYEALP IIYKNGDIVRFHRLKIQVYKKETQGITSSGFASLTFEGTLGAPIIPRTSSKYFNFTTEDHKMVEALRVWA STHMSPSWTLLKLCDVQPMQYFDLTCQLLGKAEVDGASFLLKVWDGTRTPFPSWRVLIQDLVLEGDLSHI HRLQNLTIDILVYDNHVHVARSLKVGSFLRIYSLHTKLQSMNSENQTMLSLEFHLHGGTSYGRGIRVLPE SNSDVDQLKKDLESANLTANQHSDVICQSEPDDSFPSSGSVSLYEVERCQQLSATILTDHQYLERTPLCA ILKQKAPQQYRIRAKLRSYKPRRLFQSVKLHCPKCHLLQEVPHEGDLDIIFQDGATKTPVVKLQNTSLYD SKIWTTKNQKGRKVAVHFVKNNGILPLSNECLLLIEGGTLSEICKLSNKFNSVIPVRSGHEDLELLDLSA PFLIQGTIHHYGCKQCSSLRSIQNLNSLVDKTSWIPSSVAEALGIVPLQYVFVMTFTLDDGTGVLEAYLM DSDKFFQIPASEVLMDDDLQKSVDMIMDMFCPPGIKIDAYPWLECFIKSYNVTNGTDNQICYQIFDTTVA EDVITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | POT1 protection of telomeres 1 [ Homo sapiens (human) ] |
Official Symbol | POT1 |
Synonyms | GLM9; CMM10; HPOT1 |
Gene ID | 25913 |
mRNA Refseq | NM_015450.3 |
Protein Refseq | NP_056265.2 |
MIM | 606478 |
UniProt ID | Q9NUX5 |
◆ Recombinant Proteins | ||
POT1-7115C | Recombinant Chicken POT1 | +Inquiry |
POT1-27935TH | Recombinant Human POT1 | +Inquiry |
POT1-141HFL | Active Recombinant Full Length Human POT1 Protein, C-Flag-tagged | +Inquiry |
POT1-1737H | Recombinant Human POT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
POT1-2788H | Recombinant Full Length Human POT1 Protein, Isoform 1, Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
POT1-3005HCL | Recombinant Human POT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POT1 Products
Required fields are marked with *
My Review for All POT1 Products
Required fields are marked with *