Active Recombinant Full Length Human VSNL1 Protein, C-Flag-tagged
Cat.No. : | VSNL1-208HFL |
Product Overview : | Recombinant Full Length Human VSNL1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is a member of the visinin/recoverin subfamily of neuronal calcium sensor proteins. The encoded protein is strongly expressed in granule cells of the cerebellum where it associates with membranes in a calcium-dependent manner and modulates intracellular signaling pathways of the central nervous system by directly or indirectly regulating the activity of adenylyl cyclase. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | WB positive control |
Molecular Mass : | 22 kDa |
AA Sequence : | MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFR TFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKM NEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | VSNL1 visinin like 1 [ Homo sapiens (human) ] |
Official Symbol | VSNL1 |
Synonyms | HLP3; VILIP; HPCAL3; HUVISL1; VILIP-1 |
Gene ID | 7447 |
mRNA Refseq | NM_003385.5 |
Protein Refseq | NP_003376.2 |
MIM | 600817 |
UniProt ID | P62760 |
◆ Recombinant Proteins | ||
VSNL1-830C | Recombinant Cynomolgus Monkey VSNL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
VSNL1-6204R | Recombinant Rat VSNL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
VSNL1-1087C | Recombinant Cynomolgus VSNL1 Protein, His-tagged | +Inquiry |
VSNL1-6566H | Recombinant Human VSNL1 protein, His-tagged | +Inquiry |
Vsnl1-6950M | Recombinant Mouse Vsnl1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VSNL1-378HCL | Recombinant Human VSNL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VSNL1 Products
Required fields are marked with *
My Review for All VSNL1 Products
Required fields are marked with *
0
Inquiry Basket