Recombinant Human VSNL1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : VSNL1-1279H
Product Overview : VSNL1 MS Standard C13 and N15-labeled recombinant protein (NP_003376) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene is a member of the visinin/recoverin subfamily of neuronal calcium sensor proteins. The encoded protein is strongly expressed in granule cells of the cerebellum where it associates with membranes in a calcium-dependent manner and modulates intracellular signaling pathways of the central nervous system by directly or indirectly regulating the activity of adenylyl cyclase. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined.
Molecular Mass : 22.1 kDa
AA Sequence : MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name VSNL1 visinin-like 1 [ Homo sapiens (human) ]
Official Symbol VSNL1
Synonyms VSNL1; visinin-like 1; visinin-like protein 1; hippocalcin like protein 3; HLP3; HPCAL3; HUVISL1; VILIP; VILIP 1; VLP-1; hippocalcin-like protein 3; VILIP-1;
Gene ID 7447
mRNA Refseq NM_003385
Protein Refseq NP_003376
MIM 600817
UniProt ID P62760

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VSNL1 Products

Required fields are marked with *

My Review for All VSNL1 Products

Required fields are marked with *

0
cart-icon