Recombinant Human VSNL1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | VSNL1-1279H |
Product Overview : | VSNL1 MS Standard C13 and N15-labeled recombinant protein (NP_003376) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene is a member of the visinin/recoverin subfamily of neuronal calcium sensor proteins. The encoded protein is strongly expressed in granule cells of the cerebellum where it associates with membranes in a calcium-dependent manner and modulates intracellular signaling pathways of the central nervous system by directly or indirectly regulating the activity of adenylyl cyclase. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined. |
Molecular Mass : | 22.1 kDa |
AA Sequence : | MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | VSNL1 visinin-like 1 [ Homo sapiens (human) ] |
Official Symbol | VSNL1 |
Synonyms | VSNL1; visinin-like 1; visinin-like protein 1; hippocalcin like protein 3; HLP3; HPCAL3; HUVISL1; VILIP; VILIP 1; VLP-1; hippocalcin-like protein 3; VILIP-1; |
Gene ID | 7447 |
mRNA Refseq | NM_003385 |
Protein Refseq | NP_003376 |
MIM | 600817 |
UniProt ID | P62760 |
◆ Recombinant Proteins | ||
VSNL1-1025H | Recombinant Human VSNL1 Protein, MYC/DDK-tagged | +Inquiry |
VSNL1-624H | Recombinant Human VSNL1 Protein, His-tagged | +Inquiry |
VSNL1-447H | Recombinant Human VSNL1 | +Inquiry |
VSNL1-830C | Recombinant Cynomolgus Monkey VSNL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
VSNL1-2347H | Recombinant Human VSNL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VSNL1-378HCL | Recombinant Human VSNL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VSNL1 Products
Required fields are marked with *
My Review for All VSNL1 Products
Required fields are marked with *
0
Inquiry Basket