Active Recombinant Human AXL, Fc-tagged

• Cat.No.: AXL-538H
• Product Overview: The recombinant human AXL-Fc fusion is expressed as a 650 amino acid protein consisting of Ala26 - Ser447 region of AXL and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

Specification

• Species: Human
• Source: Human Cells
• Tag: Fc
• Protein Length: 26-447 a.a.
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free).
• Bio-activity: Interacts with human Gas6 and inhibits Gas6/AXLmediated signaling activity.
• Molecular Mass: Calculated molecular mass (kDa): 71.1; Estimated by SDS-PAGE under reducing condition (kDa): 80-90
• AA Sequence: APRGTQAEESPFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVV SQLRITSLQLSDTGQYQCLVFLGHQTFVSQPGYVGLEGLPYFLEEPEDRTVAANTPFNLSCQAQGPPEPVDLLW LQDAVPLATAPGHGPQRSLHVPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQQPRNLHLVSRQPTELEVAWTP GLSGIYPLTHCTLQAVLSDDGMGIQAGEPDPPEEPLTSQASVPPHQLRLGSLHPHTPYHIRVACTSSQGPSSWT HWLPVETPEGVPLGPPENISATRNGSQAFVHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQ GDGSVSNLTVCVAAYTAAGDGPWSLPVPLEAWRPGQAQPVHQLVKEPSTPAFSSTGTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the
• Purity: >95% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.

Gene Information

• Gene Name: AXL AXL receptor tyrosine kinase [ Homo sapiens ]
• Official Symbol: AXL
• Synonyms: AXL; AXL receptor tyrosine kinase; tyrosine-protein kinase receptor UFO; JTK11; UFO; AXL oncogene; oncogene AXL; AXL transforming sequence/gene
• Gene ID: 558
• mRNA Refseq: NM_001699
• Protein Refseq: NP_001690
• MIM: 109135
• UniProt ID: P30530
• Chromosome Location: 19q13.1
• Function: ATP binding; nucleotide binding; protein heterodimerization activity; receptor activity; transmembrane receptor protein tyrosine kinase activity

Citation

Efficacy of newly discovered DNA aptamers targeting AXL in a lung cancer cell with acquired resistance to Erlotinib

Journal: Translational Cancer Research    PubMed ID: 35116429    Data: 2021/2/1

Authors: Ji An Hwang, Jae Young Hur, Chang-Min Choi

Article Snippet:The resulting aptamers were used in the next SELEX rounds.The resulting aptamers were used in the next SELEX rounds.. The target protein used for aptamers selection were recombinant Human AXL extracellular domain (Met 1-Pro 449), fused with a polyhistidine tag at the C-terminus produced in Human Cell (Creative BioMart, Shirley, NY, USA).

Effects of aptamers in lung cancer cell lines. (A) Cell viability after the treatment of aptamers that selectively bind to AXL receptors in HCC827/ER cells. Cell viability was measured after 72-hr treatment of each aptamer in the concentration of 200 nM. Cell viability was measured using the CCK-8 assay. Results are representative of at least 3 independent experiments, and the error bars signify standard deviations (± SD). (B) Immunoblot analysis of AXL, phospho-AXL, Akt, phospho-Akt, Erk, and phospho-Erk. HCC827/ER and H2009 cells were treated with each aptamers (200 nM) for 72 hrs. Actin serves as a loading control.

Efficacy of aptamers and their combined treatment of erlotinib in HCC827/ER cells. (A) Cell viability after treatment with the aptamers targeting AXL (49 and 81). Cells were treated with aptamers at indicated doses for 72 hrs. (B) Efficacy of the combination of erlotinib with an aptamer. Cells were treated with multiple incremental doses of each aptamer in combination with the fixed dose (1 μM) of erlotinib for 72 hrs. (C) Efficacy of the combination of erlotinib with an aptamer. Cells were treated with multiple incremental doses of erlotinib in combination with the fixed dose (200 nM) of each aptamer for 72 hrs. Cell viability was measured using the CCK-8 assay. Results are representative of at least 3 independent experiments, and the error bars signify standard deviations (± SD).

Binding affinity of aptamers to the AXL receptor