Active Recombinant Human AXL, Fc-tagged
Cat.No. : | AXL-538H |
Product Overview : | The recombinant human AXL-Fc fusion is expressed as a 650 amino acid protein consisting of Ala26 - Ser447 region of AXL and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 26-447 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). |
Bio-activity : | Interacts with human Gas6 and inhibits Gas6/AXLmediated signaling activity. |
Molecular Mass : | Calculated molecular mass (kDa): 71.1; Estimated by SDS-PAGE under reducing condition (kDa): 80-90 |
AA Sequence : | APRGTQAEESPFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVV SQLRITSLQLSDTGQYQCLVFLGHQTFVSQPGYVGLEGLPYFLEEPEDRTVAANTPFNLSCQAQGPPEPVDLLW LQDAVPLATAPGHGPQRSLHVPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQQPRNLHLVSRQPTELEVAWTP GLSGIYPLTHCTLQAVLSDDGMGIQAGEPDPPEEPLTSQASVPPHQLRLGSLHPHTPYHIRVACTSSQGPSSWT HWLPVETPEGVPLGPPENISATRNGSQAFVHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQ GDGSVSNLTVCVAAYTAAGDGPWSLPVPLEAWRPGQAQPVHQLVKEPSTPAFSSTGTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | AXL AXL receptor tyrosine kinase [ Homo sapiens ] |
Official Symbol | AXL |
Synonyms | AXL; AXL receptor tyrosine kinase; tyrosine-protein kinase receptor UFO; JTK11; UFO; AXL oncogene; oncogene AXL; AXL transforming sequence/gene; |
Gene ID | 558 |
mRNA Refseq | NM_001699 |
Protein Refseq | NP_001690 |
MIM | 109135 |
UniProt ID | P30530 |
Chromosome Location | 19q13.1 |
Function | ATP binding; nucleotide binding; protein heterodimerization activity; receptor activity; transmembrane receptor protein tyrosine kinase activity; |
◆ Recombinant Proteins | ||
AXL-202H | Active Recombinant Human AXL (R499C), GST-tagged | +Inquiry |
AXL-592HFL | Recombinant Full Length Human AXL Protein, C-Flag-tagged | +Inquiry |
Axl-2894C | Recombinant Cynomolgus Axl protein, His-tagged | +Inquiry |
AXL-167H | Recombinant Human AXL Protein, His (Fc)-Avi-tagged | +Inquiry |
AXL-1049H | Recombinant Human AXL protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AXL-2281HCL | Recombinant Human AXL cell lysate | +Inquiry |
AXL-2476MCL | Recombinant Mouse AXL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AXL Products
Required fields are marked with *
My Review for All AXL Products
Required fields are marked with *
0
Inquiry Basket