Active Recombinant Human BTC Protein (80 aa)

Cat.No. : BTC-135B
Product Overview : Recombinant Human BTC Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 80
Description : Betacellulin (BTC) is a member of the EGF family of cytokines that also includes EGF, TGF-a, Amphiregulin, HB-EGF, Epiregulin, Tomoregulin and the Neuregulins. At the amino acid sequence level, human mature BTC protein exhibits 80% identity with mouse BTC protein. BTC is expressed in most tissues including kidney, uterus, liver and pancreas. It is also present in body fluids, including serum, milk, and colostrum.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : The ED50 was determined by the dose-dependent stimulation of the proliferation of murine Balb/3T3 cells is ≤ 0.05 ng/mL, corresponding to a specific activity of ≥ 2 × 10^7units/mg.
Molecular Mass : Recombinant human Betacellulin is a 9.0 kDa monomeric protein, containing 80 amino residues, which comprises the mature EGF homologous portion of the Betacellulin protein.
AA Sequence : DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY
Endotoxin : Less than 1 EU/μg of rHuBetacellulin as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer : Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20C. Further dilutions should be made in appropriate buffered solutions.
Gene Name BTC betacellulin [ Homo sapiens ]
Official Symbol BTC
Synonyms BTC; betacellulin; probetacellulin;
Gene ID 685
mRNA Refseq NM_001729
Protein Refseq NP_001720
MIM 600345
UniProt ID P35070

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BTC Products

Required fields are marked with *

My Review for All BTC Products

Required fields are marked with *

0
cart-icon