Active Recombinant Human BTC Protein (80 aa)
Cat.No. : | BTC-135B |
Product Overview : | Recombinant Human BTC Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 80 |
Description : | Betacellulin (BTC) is a member of the EGF family of cytokines that also includes EGF, TGF-a, Amphiregulin, HB-EGF, Epiregulin, Tomoregulin and the Neuregulins. At the amino acid sequence level, human mature BTC protein exhibits 80% identity with mouse BTC protein. BTC is expressed in most tissues including kidney, uterus, liver and pancreas. It is also present in body fluids, including serum, milk, and colostrum. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | The ED50 was determined by the dose-dependent stimulation of the proliferation of murine Balb/3T3 cells is ≤ 0.05 ng/mL, corresponding to a specific activity of ≥ 2 × 10^7units/mg. |
Molecular Mass : | Recombinant human Betacellulin is a 9.0 kDa monomeric protein, containing 80 amino residues, which comprises the mature EGF homologous portion of the Betacellulin protein. |
AA Sequence : | DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY |
Endotoxin : | Less than 1 EU/μg of rHuBetacellulin as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20C. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | BTC betacellulin [ Homo sapiens ] |
Official Symbol | BTC |
Synonyms | BTC; betacellulin; probetacellulin; |
Gene ID | 685 |
mRNA Refseq | NM_001729 |
Protein Refseq | NP_001720 |
MIM | 600345 |
UniProt ID | P35070 |
◆ Recombinant Proteins | ||
BTC-395H | Active Recombinant Human BTC protein(Met1-Tyr111), hFc-tagged | +Inquiry |
Btc-425M | Recombinant Mouse Btc protein(Met1-Gln118), His&hFc-tagged | +Inquiry |
BTC-58C | Recombinant Cynomolgus BTC, Fc tagged | +Inquiry |
BTC-135B | Active Recombinant Human BTC Protein (80 aa) | +Inquiry |
BTC-10315H | Recombinant Human BTC, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTC-933HCL | Recombinant Human BTC cell lysate | +Inquiry |
BTC-2505MCL | Recombinant Mouse BTC cell lysate | +Inquiry |
BTC-1049CCL | Recombinant Cynomolgus BTC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTC Products
Required fields are marked with *
My Review for All BTC Products
Required fields are marked with *
0
Inquiry Basket