Active Recombinant Human CCL14 Protein (72 aa)

• Cat.No.: CCL14-384C
• Product Overview: Recombinant human Hemofiltrate CC Chemokine-1 (HCC-1)/CCL14 (rhHCC-1) produced in E. coli is a single non-glycosylated polypeptide chain containing 72 amino acids. A fully biologically active molecule, rhHCC-1 has a molecular mass of 8.4kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 72
• Description: HCC-1/CCL14 is a member of the chemokine family, which are small chemotactic proteins that regulate cell migration under inflammatory and steady state conditions. HCC-1 is expressed in epithelial and decidual cells and is unique among chemokines due to its high abundance in normal human plasma. HCC-1 can bind to chemokine receptors CCR1 and CCR5, however full length HCC-1 is a weak agonist of CCR1 and only becomes potent after removal of its eight N-terminal residues. Chemokine decoy receptor D6 can bind HCC-1 and promote its degradation as a means to regulate its level in vivo. Functionally HCC-1 promotes trophoblast migration by regulating extracellular matrix components as well as specific adhesion molecules.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 25 μg/mL, measured by the FLIPR assay using CHO cells transfected with human CCR5, the receptor of human CCL14, corresponding to a specific activity of > 40 units/mg.
• Molecular Mass: 8.4 kDa, observed by reducing SDS-PAGE.
• AA Sequence: TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE analysis.
• Storage: Lyophilized recombinant human Hemofiltrate CC Chemokine-1 (72 a.a.) (HCC-1)/CCL14 (rhHCC-1) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhHCC-1 remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: CCL14 chemokine (C-C motif) ligand 14 [ Homo sapiens ]
• Official Symbol: CCL14
• Synonyms: CCL14; chemokine (C-C motif) ligand 14; SCYA14, small inducible cytokine subfamily A (Cys Cys), member 14; C-C motif chemokine 14; CKb1; HCC 1; HCC 3; MCIF; NCC 2; SCYL2; chemokine CC-3; new CC chemokine 2; chemokine CC-1/CC-3; hemofiltrate CC chemokine 1; small-inducible cytokine A14; small inducible cytokine subfamily A (Cys-Cys), member 14; CC-1; CC-3; CKB1; NCC2; SY14; HCC-1; HCC-3; NCC-2; SCYA14; HCC-1(1-74); HCC-1/HCC-3; FLJ16015
• Gene ID: 6358
• mRNA Refseq: NM_032962
• Protein Refseq: NP_116738
• MIM: 601392
• UniProt ID: Q16627