Active Recombinant Human CCL14 Protein (72 aa)
Cat.No. : | CCL14-384C |
Product Overview : | Recombinant human Hemofiltrate CC Chemokine-1 (HCC-1)/CCL14 (rhHCC-1) produced in E. coli is a single non-glycosylated polypeptide chain containing 72 amino acids. A fully biologically active molecule, rhHCC-1 has a molecular mass of 8.4kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 72 |
Description : | HCC-1/CCL14 is a member of the chemokine family, which are small chemotactic proteins that regulate cell migration under inflammatory and steady state conditions. HCC-1 is expressed in epithelial and decidual cells and is unique among chemokines due to its high abundance in normal human plasma. HCC-1 can bind to chemokine receptors CCR1 and CCR5, however full length HCC-1 is a weak agonist of CCR1 and only becomes potent after removal of its eight N-terminal residues. Chemokine decoy receptor D6 can bind HCC-1 and promote its degradation as a means to regulate its level in vivo. Functionally HCC-1 promotes trophoblast migration by regulating extracellular matrix components as well as specific adhesion molecules. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 25 μg/mL, measured by the FLIPR assay using CHO cells transfected with human CCR5, the receptor of human CCL14, corresponding to a specific activity of > 40 units/mg. |
Molecular Mass : | 8.4 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% by SDS-PAGE analysis. |
Storage : | Lyophilized recombinant human Hemofiltrate CC Chemokine-1 (72 a.a.) (HCC-1)/CCL14 (rhHCC-1) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhHCC-1 remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | CCL14 chemokine (C-C motif) ligand 14 [ Homo sapiens ] |
Official Symbol | CCL14 |
Synonyms | CCL14; chemokine (C-C motif) ligand 14; SCYA14, small inducible cytokine subfamily A (Cys Cys), member 14; C-C motif chemokine 14; CKb1; HCC 1; HCC 3; MCIF; NCC 2; SCYL2; chemokine CC-3; new CC chemokine 2; chemokine CC-1/CC-3; hemofiltrate CC chemokine 1; small-inducible cytokine A14; small inducible cytokine subfamily A (Cys-Cys), member 14; CC-1; CC-3; CKB1; NCC2; SY14; HCC-1; HCC-3; NCC-2; SCYA14; HCC-1(1-74); HCC-1/HCC-3; FLJ16015; |
Gene ID | 6358 |
mRNA Refseq | NM_032962 |
Protein Refseq | NP_116738 |
MIM | 601392 |
UniProt ID | Q16627 |
◆ Recombinant Proteins | ||
CCL14-033H | Recombinant Human CCL14 Protein, His-tagged | +Inquiry |
CCL14-0609H | Recombinant Human CCL14 Protein, GST-Tagged | +Inquiry |
CCL14-1527H | Recombinant Human CCL14 protein, His & GST-tagged | +Inquiry |
CCL14-334H | Active Recombinant Human Chemokine (C-C Motif) Ligand 14, MIgG2a Fc-tagged | +Inquiry |
CCL14-74H | Recombinant Human CCL14 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL14-7732HCL | Recombinant Human CCL14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL14 Products
Required fields are marked with *
My Review for All CCL14 Products
Required fields are marked with *