Active Recombinant Human CCL3 Protein (70 aa)

Cat.No. : CCL3-330C
Product Overview : Recombinant human MIP-1 alpha/CCL3 (rhMIP-1 alpha) produced in E. coli is a single non-glycosylated polypeptide chain containing 70 amino acids. A fully biologically active molecule, rhMIP-1 alpha has a molecular mass of 7.8 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 70
Description : MIP-1 alpha/CCL3, also known as LD78 alpha, is an inflammatory chemokine. MIP-1α belongs to the CCL chemokine family, and shares 68% homology with MIP-1β. The mature form of MIP-1α contains 69 amino acids, exists as dimers in solution, and tends to undergo reversible aggregation. The receptors of MIP-1αin vivo are mainly the G-protein coupled receptors CCR1 and CCR5. Upon stimulation by endogenous and exogenous agents such as Interleukin-1β, Interferon-γ, and lipoteichoic acid from Gram-positive bacteria, monocytes are able to secrete significant amounts of MIP-1α. MIP-1α augments the adhesions of T lymphocytes, monocytes, and neutrophils to vascular cell adhesion molecule 1. In addition, in wounds, MIP-1α chemo-attracts macrophages in order to accelerate the tissue repair process.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 80 ng/mL, measured by the FLIPR assay using CHO cells transfected with human CCR5, the receptor of human CCL3, corresponding to a specific activity of > 1.25 × 10^4 units/mg.
Molecular Mass : 7.8 kDa, observed by reducing SDS-PAGE.
AA Sequence : ASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant human MIP-1 alpha/CCL3 (rhMIP-1 alpha) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhMIP-1 alpha remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name CCL3 chemokine (C-C motif) ligand 3 [ Homo sapiens ]
Official Symbol CCL3
Synonyms CCL3; chemokine (C-C motif) ligand 3; SCYA3, small inducible cytokine A3 (homologous to mouse Mip 1a); C-C motif chemokine 3; G0S19 1; LD78ALPHA; MIP 1 alpha; SIS-beta; PAT 464.1; G0/G1 switch regulatory protein 19-1; macrophage inflammatory protein 1-alpha; tonsillar lymphocyte LD78 alpha protein; small inducible cytokine A3 (homologous to mouse Mip-1a); MIP1A; SCYA3; G0S19-1; MIP-1-alpha;
Gene ID 6348
mRNA Refseq NM_002983
Protein Refseq NP_002974
MIM 182283
UniProt ID P10147

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL3 Products

Required fields are marked with *

My Review for All CCL3 Products

Required fields are marked with *

0
cart-icon