Active Recombinant Human CCL4 Protein (69 aa)
Cat.No. : | CCL4-329C |
Product Overview : | Recombinant MIP-1 beta/CCL4 produced in E. coli is a single non-glycosylated polypeptide chain containing 69 amino acids. A fully biologically active molecule, rhMIP-1 beta/CCL4 has a molecular mass of 7.6 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 69 |
Description : | Macrophage inflammatory protein 1 beta (MIP-1β), also known as Chemokine (C-C motif) ligand 4(CCL4), is a small cytokine belonging to the CC chemokine family. It is a chemoattractant for natural killer cells, monocytes and a variety of other immune cells. MIP-1βis a major HIV-suppressive factor produced by CD8+ T cells. Perforin-low memory CD8+ T cells are the most common T-cells that normally synthesize MIP-1-beta in humans. MIP-1βhas been shown to interact with CCL3. It can signal through the CCR5 receptor. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | The EC50 value of human MIP-1 beta/CCL4 on Ca^2+ mobilization assay in CHO-K1/Gα15/hCCR5 cells (human Gα15 and human CCR5 stably expressed in CHO-K1 cells) is less than 100 ng/mL. |
Molecular Mass : | 7.6 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
Storage : | Lyophilized recombinant human MIP-1 beta/CCL4 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, human MIP-1 beta/CCL4 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | CCL4 chemokine (C-C motif) ligand 4 [ Homo sapiens ] |
Official Symbol | CCL4 |
Synonyms | CCL4; chemokine (C-C motif) ligand 4; LAG1, SCYA4, small inducible cytokine A4 (homologous to mouse Mip 1b); C-C motif chemokine 4; Act 2; AT744.1; MIP 1 beta; PAT 744; SIS-gamma; MIP-1-beta(1-69); CC chemokine ligand 4; secreted protein G-26; T-cell activation protein 2; small-inducible cytokine A4; lymphocyte-activation gene 1; G-26 T-lymphocyte-secreted protein; lymphocyte activation gene 1 protein; macrophage inflammatory protein 1-beta; small inducible cytokine A4 (homologous to mouse Mip-1b); ACT2; G-26; HC21; LAG1; LAG-1; MIP1B; SCYA2; SCYA4; MIP1B1; MIP-1-beta; MGC104418; MGC126025; MGC126026; |
Gene ID | 6351 |
mRNA Refseq | NM_002984 |
Protein Refseq | NP_002975 |
MIM | 182284 |
UniProt ID | P13236 |
◆ Recombinant Proteins | ||
CCL4-023H | Recombinant Human CCL4 Protein, Biotinylated | +Inquiry |
CCL4-872R | Recombinant Rat CCL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCL4-25H | Recombinant Human CCL4 Protein | +Inquiry |
CCL4-269H | Active Recombinant Human CCL4 Protein (Ala24-Asn92), Animal-free, Carrier-free | +Inquiry |
CCL4-1143H | Recombinant Human CCL4 Protein (Met26-Asn92), GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL4-7721HCL | Recombinant Human CCL4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL4 Products
Required fields are marked with *
My Review for All CCL4 Products
Required fields are marked with *
0
Inquiry Basket