Active Recombinant Human CCL8 Protein (76 aa)

Cat.No. : CCL8-336C
Product Overview : Recombinant human MCP-2/CCL8(rhMCP-2) produced in E. coli is a single non-glycosylated polypeptide chain containing 76 amino acids. A fully biologically active molecule, rhMCP-2 has a molecular mass of 8.9kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 76
Description : MCP-2 is a member of the chemokines, a group of 70-80 residue proteins sharing substantial sequence similarity. Within the chemokines, MCP-2 belongs to the CC subfamily, and is a member of the Monocyte Chemoattractant Proteins (MCPs), which includes MCP-1, MCP-2, MCP-3, MCP-4, and MCP-5. MCP-2 shares 60% homology with MCP-1, and both proteins can undergo reversible dimerization. The main receptors of MCP-2 are G-protein coupled receptors CCR1 and CCR5. MCP-2 is a potential target in HIV-1 infected human glial cells as it may play a role in the modulation of viral spread in the brain. Recently, researchers found that mouse MCP-2 is expressed in the skin as a novel agonist of CCR8 and plays a role in eosinophilic inflammation.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50< 0.5 μg/mL, measured by the FLIPR assay using CHO cells transfected with human CCR5, the receptor of human CCL8, corresponding to a specific activity of > 2 × 10^3 units/mg.
Molecular Mass : 8.9 kDa, observed by reducing SDS-PAGE.
AA Sequence : QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% by SDS-PAGE analysis.
Storage : Lyophilized recombinant human MCP-2/CCL8(rhMCP-2) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhMCP-2 remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name CCL8 chemokine (C-C motif) ligand 8 [ Homo sapiens ]
Official Symbol CCL8
Synonyms CCL8; chemokine (C-C motif) ligand 8; SCYA8, small inducible cytokine subfamily A (Cys Cys), member 8 (monocyte chemotactic protein 2); C-C motif chemokine 8; HC14; MCP 2; small-inducible cytokine A8; monocyte chemotactic protein 2; monocyte chemoattractant protein 2; small inducible cytokine subfamily A (Cys-Cys), member 8 (monocyte chemotactic protein 2); MCP2; MCP-2; SCYA8; SCYA10;
Gene ID 6355
mRNA Refseq NM_005623
Protein Refseq NP_005614
MIM 602283
UniProt ID P80075

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL8 Products

Required fields are marked with *

My Review for All CCL8 Products

Required fields are marked with *

0
cart-icon