Active Recombinant Human CXCL8 Protein (77 aa)
Cat.No. : | CXCL8-107C |
Product Overview : | Recombinant Human CXCL8 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 77 |
Description : | Interleukin 8/CXCL8 was originally discovered and purified independently by a number of laboratories as a neutrophil chemotactic and activating factor. It was also referred to as neutrophil chemotactic factor (NCF), neutrophil activating protein (NAP), monocytederived neutrophil chemotactic factor (MDNCF), T-lymphocyte chemotactic factor (TCF), granulocyte chemotactic protein (GCP) and leukocyte adhesion inhibitor (LAI). Many cell types, including monocyte/macrophages, T cells, neutrophils, fibroblasts, endothelial cells, keratinocytes, hepatocytes, chondrocytes, and various tumor cell lines, can produce CXCL8 in response to a wide variety of pro-inflammatory stimuli such as exposure to IL-1, TNF, LPS, and viruses. CXCL8 is a member of the alpha (C-X-C) subfamily of chemokines, which also includes platelet factor 4, GRO, IP-10, etc. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active when compared to standard. Determined by its ability to chemoattract human peripheral blood neutrophils using a concentration range of 25-150 ng/mL, corresponding to a Specific Activity of >6.7× 10^3 IU/mg. |
Molecular Mass : | 8,904 Da, a single, non-glycosylated polypeptide chain containing 77 amino acids. |
AA Sequence : | AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS |
Endotoxin : | Less than 1 EU/mg of rHuIL-8 as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | CXCL8 C-X-C motif chemokine ligand 8 [ Homo sapiens (human) ] |
Official Symbol | CXCL8 |
Synonyms | CXCL8; C-X-C motif chemokine ligand 8; IL8; NAF; GCP1; LECT; LUCT; NAP1; GCP-1; LYNAP; MDNCF; MONAP; NAP-1; SCYB8; interleukin-8; T-cell chemotactic factor; alveolar macrophage chemotactic factor I; beta endothelial cell-derived neutrophil activating peptide; beta-thromboglobulin-like protein; chemokine (C-X-C motif) ligand 8; emoctakin; granulocyte chemotactic protein 1; interleukin 8; lung giant cell carcinoma-derived chemotactic protein; lymphocyte derived neutrophil activating peptide; monocyte-derived neutrophil chemotactic factor; monocyte-derived neutrophil-activating peptide; neutrophil-activating peptide 1; small inducible cytokine subfamily B, member 8; tumor necrosis factor-induced gene 1 |
Gene ID | 3576 |
mRNA Refseq | NM_000584 |
Protein Refseq | NP_000575 |
MIM | 146930 |
UniProt ID | P10145 |
◆ Recombinant Proteins | ||
CXCL8-231C | Active Recombinant Human CXCL8 Protein | +Inquiry |
CXCL8-004H | Recombinant Human CXCL8 Protein, His-tagged | +Inquiry |
CXCL8-03C | Recombinant Canine CXCL8 Protein, His-tagged | +Inquiry |
CXCL8-002C | Recombinant Rhesus Macaque CXCL8 Protein (79 aa) | +Inquiry |
CXCL8-06H | Recombinant Human CXCL8 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL8 Products
Required fields are marked with *
My Review for All CXCL8 Products
Required fields are marked with *
0
Inquiry Basket