Recombinant Canine CXCL8 Protein, His-tagged
Cat.No. : | CXCL8-03C |
Product Overview : | Recombinant canine IL-8/CXCL8 (28-101aa), fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Canine |
Source : | HEK293 |
Tag : | His |
Protein Length : | 28-101 a.a. |
Description : | IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. |
Form : | Liquid |
Molecular Mass : | 9.4 kDa (80aa) |
AA Sequence : | VSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 90% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.25 mg/mL (determined by BCA assay) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 20% glycerol |
Gene Name | CXCL8 C-X-C motif chemokine ligand 8 [ Canis lupus familiaris (dog) ] |
Official Symbol | CXCL8 |
Synonyms | CXCL8; C-X-C motif chemokine ligand 8; IL8; interleukin-8; C-X-C motif chemokine 8; IL-8; chemokine (C-X-C motif) ligand 8 |
Gene ID | 403850 |
mRNA Refseq | NM_001003200 |
Protein Refseq | NP_001003200 |
UniProt ID | P41324 |
◆ Recombinant Proteins | ||
CXCL8-350C | Active Recombinant Human CXCL8 Protein (77 aa) | +Inquiry |
CXCL8-002C | Recombinant Rhesus Macaque CXCL8 Protein (79 aa) | +Inquiry |
CXCL8-004H | Recombinant Human CXCL8 Protein, His-tagged | +Inquiry |
CXCL8-1652HFL | Recombinant Full Length Human CXCL8 Protein, C-Flag-tagged | +Inquiry |
CXCL8-1111R | Recombinant Rhesus monkey CXCL8 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL8 Products
Required fields are marked with *
My Review for All CXCL8 Products
Required fields are marked with *