Active Recombinant Human DEFB1 Protein
Cat.No. : | DEFB1-197H |
Product Overview : | Recombinant Human DEFB1 was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 1, an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. This gene maps in close proximity to defensin family member, defensin, alpha 1 and has been implicated in the pathogenesis of cystic fibrosis. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bio-activity : | Determined by its ability to chemoattract CD34+ dendritic cells using a concentration range of 100.0-1000.0 ng/ml. |
Molecular Mass : | 3.9 kDa |
AA Sequence : | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Resuspend the protein in the desired concentration in proper buffer |
Gene Name | DEFB1 defensin, beta 1 [ Homo sapiens ] |
Official Symbol | DEFB1 |
Synonyms | DEFB1; defensin, beta 1; beta-defensin 1; BD1; DEFB 1; DEFB101; HBD 1; HBD1; MGC51822; BD-1; beta-defensin-1; DEFB-1; |
Gene ID | 1672 |
mRNA Refseq | NM_005218 |
Protein Refseq | NP_005209 |
MIM | 602056 |
UniProt ID | P60022 |
◆ Recombinant Proteins | ||
DEFB1-198H | Recombinant Human DEFB1 protein | +Inquiry |
DEFB1-6766P | Recombinant Pig DEFB1 protein, GST-tagged | +Inquiry |
DEFB1-6218C | Recombinant Chicken DEFB1 | +Inquiry |
Defb1-6879R | Recombinant Rat Defb1 protein, His-tagged | +Inquiry |
DEFB1-17H | Active Recombinant Human DEFB1 protein(1-47aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
DEFB1-6989HCL | Recombinant Human DEFB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DEFB1 Products
Required fields are marked with *
My Review for All DEFB1 Products
Required fields are marked with *
0
Inquiry Basket