Active Recombinant Human FGF10 Protein (170 aa, 40-208)

Cat.No. : FGF10-088F
Product Overview : Recombinant Human FGF10 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 170, 40-208
Description : KGF-2(also known as FGF-10) was originally identified from rat embryos by homology-based polymerase chain reaction. Human and mouse KGF-2 were subsequently cloned. The human KGF-2 cDNA encodes a 208 amino acid residue protein with a hydrophobic amino-terminal signal peptide. Human KGF-2 shares approximately 92% and 95% amino acid sequence identity with mouse and rat KGF-2, respectively. Among the FGF family members, KGF-2 is most closely related to FGF-7. The expression of KGF-2 transcripts has been shown to be most abundant in the embryo and adult lung. Recombinant KGF-2 preparations have been shown to be mitogenic for epithelial and epidermal cells but not fibroblasts. Based on its in vitro biological activities and in vivo expression pattern, KGF-2 has been proposed to play unique roles in the brain, in lung development, wound healing and limb bud formation.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : The biological activity was determined by the does-dependent stimulation of thymidine uptake by BaF3 cells expressing FGF receptors yielding an ED50 < 0.5 ng/mL., corresponding to a specific activity of 2.0 × 10^6 Units/mg.
Molecular Mass : Approximately 19.3 kDa, 170 amino acid residues consisting of Methionine and the mature human KGF-2 (amino acid residues 40-208).
AA Sequence : MLGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS
Endotoxin : Less than 1 EU/mg of rHuKGF-2 as determined by LAL method.
Purity : >96% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer : Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name FGF10 fibroblast growth factor 10 [ Homo sapiens (human) ]
Official Symbol FGF10
Synonyms FGF10; fibroblast growth factor 10; LADD3; ; FGF-10; keratinocyte growth factor 2; produced by fibroblasts of urinary bladder lamina propria
Gene ID 2255
mRNA Refseq NM_004465
Protein Refseq NP_004456
MIM 602115
UniProt ID O15520

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGF10 Products

Required fields are marked with *

My Review for All FGF10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon