Species : |
Human |
Source : |
E.coli |
Protein Length : |
170, 40-208 |
Description : |
KGF-2(also known as FGF-10) was originally identified from rat embryos by homology-based polymerase chain reaction. Human and mouse KGF-2 were subsequently cloned. The human KGF-2 cDNA encodes a 208 amino acid residue protein with a hydrophobic amino-terminal signal peptide. Human KGF-2 shares approximately 92% and 95% amino acid sequence identity with mouse and rat KGF-2, respectively. Among the FGF family members, KGF-2 is most closely related to FGF-7. The expression of KGF-2 transcripts has been shown to be most abundant in the embryo and adult lung. Recombinant KGF-2 preparations have been shown to be mitogenic for epithelial and epidermal cells but not fibroblasts. Based on its in vitro biological activities and in vivo expression pattern, KGF-2 has been proposed to play unique roles in the brain, in lung development, wound healing and limb bud formation. |
Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : |
The biological activity was determined by the does-dependent stimulation of thymidine uptake by BaF3 cells expressing FGF receptors yielding an ED50 < 0.5 ng/mL., corresponding to a specific activity of 2.0 × 10^6 Units/mg. |
Molecular Mass : |
Approximately 19.3 kDa, 170 amino acid residues consisting of Methionine and the mature human KGF-2 (amino acid residues 40-208). |
AA Sequence : |
MLGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS |
Endotoxin : |
Less than 1 EU/mg of rHuKGF-2 as determined by LAL method. |
Purity : |
>96% by SDS-PAGE and HPLC analyses. |
Storage : |
This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : |
Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |