Active Recombinant Human FGF10 Protein (170 aa, 40-208)
Cat.No. : | FGF10-088F |
Product Overview : | Recombinant Human FGF10 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 170, 40-208 |
Description : | KGF-2(also known as FGF-10) was originally identified from rat embryos by homology-based polymerase chain reaction. Human and mouse KGF-2 were subsequently cloned. The human KGF-2 cDNA encodes a 208 amino acid residue protein with a hydrophobic amino-terminal signal peptide. Human KGF-2 shares approximately 92% and 95% amino acid sequence identity with mouse and rat KGF-2, respectively. Among the FGF family members, KGF-2 is most closely related to FGF-7. The expression of KGF-2 transcripts has been shown to be most abundant in the embryo and adult lung. Recombinant KGF-2 preparations have been shown to be mitogenic for epithelial and epidermal cells but not fibroblasts. Based on its in vitro biological activities and in vivo expression pattern, KGF-2 has been proposed to play unique roles in the brain, in lung development, wound healing and limb bud formation. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | The biological activity was determined by the does-dependent stimulation of thymidine uptake by BaF3 cells expressing FGF receptors yielding an ED50 < 0.5 ng/mL., corresponding to a specific activity of 2.0 × 10^6 Units/mg. |
Molecular Mass : | Approximately 19.3 kDa, 170 amino acid residues consisting of Methionine and the mature human KGF-2 (amino acid residues 40-208). |
AA Sequence : | MLGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS |
Endotoxin : | Less than 1 EU/mg of rHuKGF-2 as determined by LAL method. |
Purity : | >96% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | FGF10 fibroblast growth factor 10 [ Homo sapiens (human) ] |
Official Symbol | FGF10 |
Synonyms | FGF10; fibroblast growth factor 10; LADD3; ; FGF-10; keratinocyte growth factor 2; produced by fibroblasts of urinary bladder lamina propria |
Gene ID | 2255 |
mRNA Refseq | NM_004465 |
Protein Refseq | NP_004456 |
MIM | 602115 |
UniProt ID | O15520 |
◆ Recombinant Proteins | ||
FGF10-4097H | Active Recombinant Human FGF10 Protein | +Inquiry |
FGF10-26H | Active Recombinant Human FGF10 Protein, Pre-aliquoted | +Inquiry |
Fgf10-197R | Recombinant Rat Fgf10 protein, His/S-tagged | +Inquiry |
FGF10-2904H | Recombinant Human FGF10 protein, GST-tagged | +Inquiry |
FGF10-452H | Recombinant Human FGF10 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF10-6251HCL | Recombinant Human FGF10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF10 Products
Required fields are marked with *
My Review for All FGF10 Products
Required fields are marked with *
0
Inquiry Basket