Active Recombinant Human FGF2 Protein (143-288aa), Non-tagged
Cat.No. : | FGF2-18H |
Product Overview : | Recombinant human FGF2 (143-288aa) protein without tag was expressed in E. coli and purified by conventional chromatography techniques. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 143-288 aa |
Description : | Fibroblast growth factor 2 (FGF2) is a member of the FGF family that binds heparin and plays important roles in morphogenic, neurotrophic and angiogenic processes. FGF2 possess diverse biological functions, such as neuron differentiation, embryonic development and differentiation, modulation of angiogenesis, and wound healing. |
Form : | Liquid |
Bio-activity : | Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells in the presence of 10 μg/mL of heparin. The ED50 range ≤ 0.2 ng/mL. |
Molecular Mass : | 16.5 kDa (147 aa) confirmed by MALDI-TOF |
AA Sequence : | MPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE, Bioactivity |
Notes : | For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 1 mg/mL (determined by Bradford assay) |
Storage Buffer : | 50 mM Tris-HCl buffer (pH 8.0) |
Gene Name | FGF2 fibroblast growth factor 2 (basic) [ Homo sapiens (human) ] |
Official Symbol | FGF2 |
Synonyms | FGF2; fibroblast growth factor 2 (basic); FGFB; fibroblast growth factor 2; prostatropin; heparin-binding growth factor 2; basic fibroblast growth factor bFGF; BFGF; FGF-2; HBGF-2 |
Gene ID | 2247 |
mRNA Refseq | NM_002006 |
Protein Refseq | NP_001997 |
MIM | 134920 |
UniProt ID | P09038 |
◆ Native Proteins | ||
FGF2-34B | Active Native Bovine bFGF | +Inquiry |
FGF2-26551TH | Native Human FGF2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF2-638HCL | Recombinant Human FGF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF2 Products
Required fields are marked with *
My Review for All FGF2 Products
Required fields are marked with *
0
Inquiry Basket