Active Recombinant Human FGF2 Protein (143-288aa), Non-tagged

Cat.No. : FGF2-18H
Product Overview : Recombinant human FGF2 (143-288aa) protein without tag was expressed in E. coli and purified by conventional chromatography techniques.
Availability April 29, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 143-288 aa
Description : Fibroblast growth factor 2 (FGF2) is a member of the FGF family that binds heparin and plays important roles in morphogenic, neurotrophic and angiogenic processes. FGF2 possess diverse biological functions, such as neuron differentiation, embryonic development and differentiation, modulation of angiogenesis, and wound healing.
Form : Liquid
Bio-activity : Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells in the presence of 10 μg/mL of heparin. The ED50 range ≤ 0.2 ng/mL.
Molecular Mass : 16.5 kDa (147 aa) confirmed by MALDI-TOF
AA Sequence : MPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Notes : For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1 mg/mL (determined by Bradford assay)
Storage Buffer : 50 mM Tris-HCl buffer (pH 8.0)
Gene Name FGF2 fibroblast growth factor 2 (basic) [ Homo sapiens (human) ]
Official Symbol FGF2
Synonyms FGF2; fibroblast growth factor 2 (basic); FGFB; fibroblast growth factor 2; prostatropin; heparin-binding growth factor 2; basic fibroblast growth factor bFGF; BFGF; FGF-2; HBGF-2
Gene ID 2247
mRNA Refseq NM_002006
Protein Refseq NP_001997
MIM 134920
UniProt ID P09038

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FGF2 Products

Required fields are marked with *

My Review for All FGF2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon