| Species : |
Bovine |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
147 |
| Description : |
Bovine bFGF, encoded by the FGF2 gene, is a member of the fibroblast growth factor (FGF) family. Fibroblast growth factor was found in pituitary extracts in 1973 and then tested in a bioassay that caused fibroblasts to proliferate. After further fractionating the extract using acidic and basic pH, twodifferent forms have isolated thatnamed "acidic fibroblast growth factor" (FGF-1) and "basic fibroblast growth factor" (FGF-2). Bovine bFGF shares 95 % amino acidsequence identity with murine bFGF, and 97 % amino acidsequence identity with rat. Affinity between bFGF and its receptors can be increased by heparin or heparan sulfate proteoglycan. bFGF plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. It is also involved in a variety of biological processes, including embryonic development, morphogenesis, tissue repair, tumor growth and invasion. Additionally, bFGF is frequently used for a critical component of cell culture medium, e.g.,human embryonic stem cell culture medium, serum-free culture systems. |
| Form : |
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
| Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine balb/c 3T3 cells is less than 0.1 ng/ml, corresponding to a specific activity of > 1.0 × 10⁷ IU/mg. |
| Molecular Mass : |
Approximately 16.5 kDa, a single non-glycosylated polypeptide chain containing 147 amino acids. |
| AA Sequence : |
MPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS |
| Endotoxin : |
Less than 1 EU/µg of rBobFGF as determined by LAL method. |
| Purity : |
>97% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |