Active Recombinant Human GSTP1 Protein (1-210aa), N-His tagged

Cat.No. : GSTP1-22H
Product Overview : Recombinant human GSTP1 protein (1-210aa) was expressed in E. coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-210aa
Description : Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. This GST family member is a polymorphic gene encoding active, functionally different GSTP1 variant proteins that are thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases.
Form : Liquid
Bio-activity : > 80 unit/mg, and is defined as the amount of enzyme that conjugate 1.0 μmole of 1-chloro-2,4-dinitrobenzene (CDNB) with reduced glutathione per minute at pH 6.5 at 25 centigrade.
Molecular Mass : 27.4 kDa (246aa) confirmed by MALDI-TOF
AA Sequence : MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE, Enzyme Activity
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.5 mg/mL (determined by Bradford assay)
Storage Buffer : 20mM Tris-HCl buffer (pH 7.0) containing 30% glycerol, 1mM EDTA, 0.1mM PMSF.
Gene Name GSTP1 glutathione S-transferase pi 1 [ Homo sapiens (human) ]
Official Symbol GSTP1
Synonyms GSTP1; glutathione S-transferase pi 1; FAEES3, GST3; glutathione S-transferase P; GSTP; GSTP1-1; GST class-pi; deafness, X-linked 7; fatty acid ethyl ester synthase III; PI; DFN7; GST3; FAEES3;
Gene ID 2950
mRNA Refseq NM_000852
Protein Refseq NP_000843
MIM 134660
UniProt ID P09211

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GSTP1 Products

Required fields are marked with *

My Review for All GSTP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon