Recombinant Full Length Human GSTP1 Protein, C-Flag-tagged
Cat.No. : | GSTP1-1202HFL |
Product Overview : | Recombinant Full Length Human GSTP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. This GST family member is a polymorphic gene encoding active, functionally different GSTP1 variant proteins that are thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 23.2 kDa |
AA Sequence : | MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTIL RHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGG KTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450, Pathways in cancer, Prostate cancer |
Full Length : | Full L. |
Gene Name | GSTP1 glutathione S-transferase pi 1 [ Homo sapiens (human) ] |
Official Symbol | GSTP1 |
Synonyms | PI; DFN7; GST3; GSTP; FAEES3; HEL-S-22 |
Gene ID | 2950 |
mRNA Refseq | NM_000852.4 |
Protein Refseq | NP_000843.1 |
MIM | 134660 |
UniProt ID | P09211 |
◆ Recombinant Proteins | ||
GSTP1-7339M | Recombinant Mouse GSTP1 Protein | +Inquiry |
GSTP1-1202HFL | Recombinant Full Length Human GSTP1 Protein, C-Flag-tagged | +Inquiry |
GSTP1-540M | Recombinant Mouse GSTP1 Protein (2-210 aa), His-SUMO-tagged | +Inquiry |
GSTP1-7786H | Recombinant Human GSTP1 protein, His-tagged | +Inquiry |
GSTP1-326C | Recombinant Cynomolgus Monkey GSTP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSTP1-5709HCL | Recombinant Human GSTP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSTP1 Products
Required fields are marked with *
My Review for All GSTP1 Products
Required fields are marked with *
0
Inquiry Basket