Active Recombinant Human IFNG Protein (144 aa)

Cat.No. : IFNG-105I
Product Overview : Recombinant Human IFNG Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 144
Description : Interferon-gamma (IFN-γ, also known as Type II interferon or immune interferon) is a cytokine produced primarily by T-lymphocytes and natural killer cells. The protein shares no significant homology with IFN-β or the various IFN-α family proteins. Mature IFN-γ exists as noncovalently-linked homodimers. Human IFN-γ is highly species specific and is biologically active only in human and primate cells. IFN-γ was originally characterized based on its antiviral activities. The protein also exerts antiproliferative, immunoregulatory and proinflammatory activities and is thus important in host defense mechanisms. IFN-γ induces the production of cytokines, upregulates the expression of class I and II MHC antigens, Fc receptor and leukocyte adhesion molecules. It modulates macrophage effector functions, influences isotype switching and potentiates the secretion of immunoglobulins by B cells. IFN-γ also augments TH1 cell expansion and may be required for TH1 cell differentiation.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Fully biologically active when compared to standard. The specific activity as determined in a viral resistance assay is less then 0.05 ng/mL, corresponding to a specific activity of 2.0 × 10^7 IU/mg.
Molecular Mass : Approximately 17 kDa, a single non-glycosylated polypeptide chain containing 144 amino acids.
AA Sequence : MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFQGRRASQ
Endotoxin : Less than 1 EU/μg of rHuIFN-γ as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer : Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20C. Further dilutions should be made in appropriate buffered solutions.
Gene Name IFNG interferon, gamma [ Homo sapiens ]
Official Symbol IFNG
Synonyms IFNG; interferon, gamma; interferon gamma; IFN-gamma; immune interferon; IFG; IFI;
Gene ID 3458
mRNA Refseq NM_000619
Protein Refseq NP_000610
MIM 147570
UniProt ID P01579

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IFNG Products

Required fields are marked with *

My Review for All IFNG Products

Required fields are marked with *

0
cart-icon