Active Recombinant Human IFNG Protein (144 aa)
Cat.No. : | IFNG-105I |
Product Overview : | Recombinant Human IFNG Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 144 |
Description : | Interferon-gamma (IFN-γ, also known as Type II interferon or immune interferon) is a cytokine produced primarily by T-lymphocytes and natural killer cells. The protein shares no significant homology with IFN-β or the various IFN-α family proteins. Mature IFN-γ exists as noncovalently-linked homodimers. Human IFN-γ is highly species specific and is biologically active only in human and primate cells. IFN-γ was originally characterized based on its antiviral activities. The protein also exerts antiproliferative, immunoregulatory and proinflammatory activities and is thus important in host defense mechanisms. IFN-γ induces the production of cytokines, upregulates the expression of class I and II MHC antigens, Fc receptor and leukocyte adhesion molecules. It modulates macrophage effector functions, influences isotype switching and potentiates the secretion of immunoglobulins by B cells. IFN-γ also augments TH1 cell expansion and may be required for TH1 cell differentiation. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active when compared to standard. The specific activity as determined in a viral resistance assay is less then 0.05 ng/mL, corresponding to a specific activity of 2.0 × 10^7 IU/mg. |
Molecular Mass : | Approximately 17 kDa, a single non-glycosylated polypeptide chain containing 144 amino acids. |
AA Sequence : | MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFQGRRASQ |
Endotoxin : | Less than 1 EU/μg of rHuIFN-γ as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20C. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | IFNG interferon, gamma [ Homo sapiens ] |
Official Symbol | IFNG |
Synonyms | IFNG; interferon, gamma; interferon gamma; IFN-gamma; immune interferon; IFG; IFI; |
Gene ID | 3458 |
mRNA Refseq | NM_000619 |
Protein Refseq | NP_000610 |
MIM | 147570 |
UniProt ID | P01579 |
◆ Recombinant Proteins | ||
Ifng-192R | Active Recombinant Rat Ifng Protein | +Inquiry |
IFNG-084H | Active Recombinant Human IFNG Protein | +Inquiry |
IFNG-2653R | Recombinant Rat IFNG Protein, His (Fc)-Avi-tagged | +Inquiry |
IFNG-6706C | Recombinant Chicken IFNG | +Inquiry |
IFNG-117R | Recombinant Rat IFNG Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNG-001HCL | Recombinant Human IFNG cell lysate | +Inquiry |
IFNG-1797MCL | Recombinant Mouse IFNG cell lysate | +Inquiry |
IFNG-1536RCL | Recombinant Rat IFNG cell lysate | +Inquiry |
IFNG-1007FCL | Recombinant Ferret IFNG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNG Products
Required fields are marked with *
My Review for All IFNG Products
Required fields are marked with *
0
Inquiry Basket