Active Recombinant Human IL15 Protein (114 aa)

Cat.No. : IL15-369I
Product Overview : Recombinant HumanInterleukin-15 produced in E. coli is a single non-glycosylated polypeptide chain containing 114 amino acids. A fully biologically active molecule, rhIL-15 has a molecular mass of 12.8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 114
Description : Interleukin-15 (IL-15) is a cytokine with structural similarity to IL-2. Like IL-2, IL-15 binds to and signals through a complex composed of IL-2/IL-15 receptor beta chain (CD122) and the common gamma chain (gamma-C, CD132). IL-15 is secreted by mononuclear phagocytes (among other cells) following infection by virus. This cytokine induces cell proliferation of natural killer cells, which are cells of the innate immune system whose principal role is to kill virally infected cells. IL-15 can stimulate the proliferation of T-lymphocytes. Stimulation by IL-15 occurs following its interaction with IL-15Rα. This interaction may enhance IL-15'sinteraction with IL15Rβγc.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 0.5 ng/mL, determined by the dose-dependent stimulation of the proliferation of CTLL-2 cells, corresponding to a specific activity of > 2 6 units/mg.
Molecular Mass : 12.8 kDa, observed by reducing SDS-PAGE.
AA Sequence : MNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE.
Storage : Lyophilized recombinant Human Interleukin-15 (rhIL-15) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhIL-15 should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name IL15 interleukin 15 [ Homo sapiens ]
Official Symbol IL15
Synonyms IL15; interleukin 15; interleukin-15; IL 15; MGC9721; IL-15;
Gene ID 3600
mRNA Refseq NM_000585
Protein Refseq NP_000576
MIM 600554
UniProt ID P40933

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL15 Products

Required fields are marked with *

My Review for All IL15 Products

Required fields are marked with *

0
cart-icon