Species : |
Human |
Source : |
E.coli |
Tag : |
His |
Protein Length : |
121 |
Description : |
Interleukin-15 (IL-15) is a cytokine with structural similarity to IL-2. Like IL-2, IL-15 binds to and signals through a complex composed of IL-2/IL-15 receptor beta chain (CD122) and the common gamma chain (gamma-C, CD132). IL-15 is secreted by mononuclear phagocytes (amongother cells) following infection by virus. This cytokine induces cell proliferation of natural killer cells, which are cells of the innate immune system whose principal role is to kill virally infected cells. IL-15 can stimulate the proliferation of T-lymphocytes. Stimulation by IL-15 occurs following its interaction withIL-15Rα. This interaction may enhance IL-15's interaction with IL15Rβγc. |
Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : |
ED50 < 0.5 ng/mL, determined by the dose-dependent stimulation of the proliferation of CTLL-2 cells, corresponding to a specific activity of > 2 6 units/mg. |
Molecular Mass : |
13.6 kDa, observed by reducing SDS-PAGE. |
AA Sequence : |
MHHHHHHNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS |
Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
Purity : |
> 95% as analyzed by SDS-PAGE. |
Storage : |
Lyophilized recombinant Human IL-15(His-tag) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human IL-15(His-tag) should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : |
Lyophilized after extensive dialysis against PBS. |
Reconstitution : |
Reconstituted in ddH2O or PBS at 100 μg/mL. |