Active Recombinant Human IL4 Protein

Cat.No. : IL4-178H
Product Overview : Recombinant Human IL4 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Interleukin 4 (IL-4) is an immunomodulatory cytokine that functions to induce naïve helper T cells to differentiate into type 2 T helper (Th2) cells. Th2 cells subsequently produce more IL-4 in a positive feedback loop. IL-4 also promotes immunoglobulin IgG to IgE isotype switching on B cells. IL-4 binds the IL-4Rα receptor to activate STAT6 signaling.
Bio-activity : TF-1 cell proliferation, ≤250 pg/mL; ≥4.0 x 10^6 units/mg
Molecular Mass : Monomer, 15.1 kDa (130 aa)
AA Sequence : MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name IL4 interleukin 4 [ Homo sapiens (human) ]
Official Symbol IL4
Synonyms IL4; interleukin 4; interleukin-4; B cell growth factor 1; B_cell stimulatory factor 1; BCGF 1; BCGF1; BSF1; IL 4; lymphocyte stimulatory factor 1; MGC79402; binetrakin; pitrakinra; IL-4; BSF-1; BCGF-1;
Gene ID 3565
mRNA Refseq NM_000589
Protein Refseq NP_000580
MIM 147780
UniProt ID P05112

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL4 Products

Required fields are marked with *

My Review for All IL4 Products

Required fields are marked with *

0
cart-icon