Active Recombinant Human IL6 Protein (185 aa)
Cat.No. : | IL6-351I |
Product Overview : | Recombinant human Interleukin-6 (rhIL-6) produced in E. coli is a single non-glycosylated polypeptide chain containing 185 amino acids. A fully biologically active molecule, rhIL-6 has a molecular mass of 20.9 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 185 |
Description : | Interleukin-6 (IL-6, also known as IFN-β2) is a pleiotropic cytokine that plays important roles in acute phase reactions, inflammation, hematopoiesis, bone metabolism, and cancer progression. IL-6 is secreted by T cells and macrophages to stimulate immune response. IL-6 is responsible for stimulating acute phase protein synthesis, as well as the production of neutrophils in the bone marrow. It supports the growth of B cells and is antagonistic to regulatory T cells. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 0.1 ng/mL, measured by the dose-dependent stimulation of the proliferation of IL-6 dependent murine 7TD1 cells, corresponding to a specific activity of > 1 × 10^7 units/mg. |
Molecular Mass : | 20.9 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | MPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% by SDS-PAGE analysis. |
Storage : | Lyophilized recombinant human Interleukin-6 (rhIL-6) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhIL-6 should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against 1xPBS. |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | IL6 interleukin 6 (interferon, beta 2) [ Homo sapiens ] |
Official Symbol | IL6 |
Synonyms | IL6; interleukin 6 (interferon, beta 2); IFNB2; interleukin-6; BSF2; HGF; HSF; IL 6; CDF; BSF-2; IFN-beta-2; interferon beta-2; interleukin BSF-2; hybridoma growth factor; CTL differentiation factor; B-cell stimulatory factor 2; B-cell differentiation factor; IL-6; |
Gene ID | 3569 |
mRNA Refseq | NM_000600 |
Protein Refseq | NP_000591 |
MIM | 147620 |
UniProt ID | P05231 |
◆ Recombinant Proteins | ||
IL6-37H | Active Recombinant Human IL6 Protein, Animal Free | +Inquiry |
IL6-2254R | Recombinant Rhesus monkey IL6 Protein, His-tagged | +Inquiry |
IL6-5309H | Recombinant Human Interleukin 6 (interferon, beta 2), HQ-tagged | +Inquiry |
IL6-052H | Recombinant Human IL6 Mutant (R44M) Protein, Myc/DDK-tagged | +Inquiry |
IL6-3106S | Recombinant Sheep IL6 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
IL6-01SFL | Recombinant Full Length Sheep IL6 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL6-5224HCL | Recombinant Human IL6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL6 Products
Required fields are marked with *
My Review for All IL6 Products
Required fields are marked with *
0
Inquiry Basket