Active Recombinant Human IL7 Protein

Cat.No. : IL7-187H
Product Overview : Recombinant Human IL7 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Interleukin 7 (IL-7) is a hematopoietic cytokine that is an important regulator of B and T cell development. IL-7 is secreted by bone marrow and thymic stromal cells, dendritic cells, intestinal epithelial cells, hepatocytes, and keratinocytes. IL-7 signals through the interleukin 7 receptor (IL-7R) to promote the differentiation of hematopoietic stem cells into T cells, B cells, and natural killer cells. IL-7 is also a regulator of intestinal mucosal lymphocyte proliferation. Human and mouse IL-7 show species cross-reactivity.
Bio-activity : Mouse 2E8 cell proliferation, ≤1 ng/mL; ≥1.0 x 10^6 units/mg
Molecular Mass : Monomer, 17.5 kDa (153 aa)
AA Sequence : MDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 20 mM NaP, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name IL7 interleukin 7 [ Homo sapiens (human) ]
Official Symbol IL7
Synonyms IL7; interleukin 7; interleukin-7; IL 7; IL-7;
Gene ID 3574
mRNA Refseq NM_000880
Protein Refseq NP_000871
MIM 146660
UniProt ID P13232

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL7 Products

Required fields are marked with *

My Review for All IL7 Products

Required fields are marked with *

0
cart-icon