Active Recombinant Human IL7 Protein
Cat.No. : | IL7-187H |
Product Overview : | Recombinant Human IL7 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Interleukin 7 (IL-7) is a hematopoietic cytokine that is an important regulator of B and T cell development. IL-7 is secreted by bone marrow and thymic stromal cells, dendritic cells, intestinal epithelial cells, hepatocytes, and keratinocytes. IL-7 signals through the interleukin 7 receptor (IL-7R) to promote the differentiation of hematopoietic stem cells into T cells, B cells, and natural killer cells. IL-7 is also a regulator of intestinal mucosal lymphocyte proliferation. Human and mouse IL-7 show species cross-reactivity. |
Bio-activity : | Mouse 2E8 cell proliferation, ≤1 ng/mL; ≥1.0 x 10^6 units/mg |
Molecular Mass : | Monomer, 17.5 kDa (153 aa) |
AA Sequence : | MDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 20 mM NaP, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | IL7 interleukin 7 [ Homo sapiens (human) ] |
Official Symbol | IL7 |
Synonyms | IL7; interleukin 7; interleukin-7; IL 7; IL-7; |
Gene ID | 3574 |
mRNA Refseq | NM_000880 |
Protein Refseq | NP_000871 |
MIM | 146660 |
UniProt ID | P13232 |
◆ Recombinant Proteins | ||
Il7-1684R | Recombinant Rat Il7 Protein, His-tagged | +Inquiry |
IL7-53H | Active Recombinant Human Interleukin 7, HIgG1 Fc-tagged, mutant | +Inquiry |
Il7-742M | Recombinant Mouse Il7 protein, His-tagged | +Inquiry |
IL7-146H | Active Recombinant Human IL7 protein | +Inquiry |
IL7-271H | Recombinant Human IL7, StrepII-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL7-5223HCL | Recombinant Human IL7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL7 Products
Required fields are marked with *
My Review for All IL7 Products
Required fields are marked with *