Active Recombinant Human TNFRSF14 Protein (376 aa), Fc-tagged

Cat.No. : TNFRSF14-141T
Product Overview : Recombinant human HVEM-Fc (rhHVEM-Fc) produced in Sf9 insect cells is a single glycosylated polypeptide chain containing 376 amino acids. A fully biologically active molecule, rhHVEM-Fc has a molecular mass of around 45 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Sf9 Cells
Tag : Fc
Protein Length : 376
Description : Herpes Virus Entry Mediator (HVEM) is a transmembrane protein that is the receptor for TNFSF14 (also known as LIGHT) and is therefore referred to as TNFRSF14. HVEM is expressed broadly on immune cells such as T cells, natural killer (NK) cells and monocytes. The interaction of 3 molecules of LIGHT with three molecules of HVEM forms a hexameric complex that leads to the recruitment and retention of effector cells and activates NK cells to produce large amounts of IFN-γ and GM-CSF. In addition to the canonical binding partner LIGHT, HVEM can also bind to the inhibitory signaling protein, B- and T- lymphocyte attenuator (BTLA),which suppresses immune responses. Therefore, the HVEM network plays an important role in regulating immunity and the behavior of lymphocytes.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 0.1 μg/mL, measured by the neutralization assay using 929 cells in presence of 0.25 ng/mL of human TNF-beta, corresponding to a specific activity of > 1 × 10^4 units/mg.
Molecular Mass : ~45 kDa, observed by reducing SDS-PAGE.
AA Sequence : LPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKRSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% by SDS-PAGE and HPLC analyses.
Storage : Lyophilized recombinant human HVEM-Fc (rhHVEM-Fc) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhHVEM-Fc remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O
Gene Name TNFRSF14 TNF receptor superfamily member 14 [ Homo sapiens (human) ]
Official Symbol TNFRSF14
Synonyms TNFRSF14; TNF receptor superfamily member 14; TR2; ATAR; HVEA; HVEM; CD270; LIGHTR; tumor necrosis factor receptor superfamily member 14CD40-like proteinherpes virus entry mediator Atumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator)tumor necrosis factor receptor-like gene2
Gene ID 8764
mRNA Refseq NM_003820
Protein Refseq NP_003811
MIM 602746
UniProt ID Q92956

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFRSF14 Products

Required fields are marked with *

My Review for All TNFRSF14 Products

Required fields are marked with *

0
cart-icon