Active Recombinant Human TNFRSF14 Protein (376 aa), Fc-tagged

• Cat.No.: TNFRSF14-141T
• Product Overview: Recombinant human HVEM-Fc (rhHVEM-Fc) produced in Sf9 insect cells is a single glycosylated polypeptide chain containing 376 amino acids. A fully biologically active molecule, rhHVEM-Fc has a molecular mass of around 45 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.

Specification

• Species: Human
• Source: Sf9 Cells
• Tag: Fc
• Protein Length: 376
• Description: Herpes Virus Entry Mediator (HVEM) is a transmembrane protein that is the receptor for TNFSF14 (also known as LIGHT) and is therefore referred to as TNFRSF14. HVEM is expressed broadly on immune cells such as T cells, natural killer (NK) cells and monocytes. The interaction of 3 molecules of LIGHT with three molecules of HVEM forms a hexameric complex that leads to the recruitment and retention of effector cells and activates NK cells to produce large amounts of IFN-γ and GM-CSF. In addition to the canonical binding partner LIGHT, HVEM can also bind to the inhibitory signaling protein, B- and T- lymphocyte attenuator (BTLA),which suppresses immune responses. Therefore, the HVEM network plays an important role in regulating immunity and the behavior of lymphocytes.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 0.1 μg/mL, measured by the neutralization assay using 929 cells in presence of 0.25 ng/mL of human TNF-beta, corresponding to a specific activity of > 1 × 10^4 units/mg.
• Molecular Mass: ~45 kDa, observed by reducing SDS-PAGE.
• AA Sequence: LPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKRSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE and HPLC analyses.
• Storage: Lyophilized recombinant human HVEM-Fc (rhHVEM-Fc) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhHVEM-Fc remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O

Gene Information

• Gene Name: TNFRSF14 TNF receptor superfamily member 14 [ Homo sapiens (human) ]
• Official Symbol: TNFRSF14
• Synonyms: TNFRSF14; TNF receptor superfamily member 14; TR2; ATAR; HVEA; HVEM; CD270; LIGHTR; tumor necrosis factor receptor superfamily member 14CD40-like proteinherpes virus entry mediator Atumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator)tumor necrosis factor receptor-like gene2
• Gene ID: 8764
• mRNA Refseq: NM_003820
• Protein Refseq: NP_003811
• MIM: 602746
• UniProt ID: Q92956