Active Recombinant Human TNFRSF14 Protein (376 aa), Fc-tagged
Cat.No. : | TNFRSF14-141T |
Product Overview : | Recombinant human HVEM-Fc (rhHVEM-Fc) produced in Sf9 insect cells is a single glycosylated polypeptide chain containing 376 amino acids. A fully biologically active molecule, rhHVEM-Fc has a molecular mass of around 45 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Sf9 Cells |
Tag : | Fc |
Protein Length : | 376 |
Description : | Herpes Virus Entry Mediator (HVEM) is a transmembrane protein that is the receptor for TNFSF14 (also known as LIGHT) and is therefore referred to as TNFRSF14. HVEM is expressed broadly on immune cells such as T cells, natural killer (NK) cells and monocytes. The interaction of 3 molecules of LIGHT with three molecules of HVEM forms a hexameric complex that leads to the recruitment and retention of effector cells and activates NK cells to produce large amounts of IFN-γ and GM-CSF. In addition to the canonical binding partner LIGHT, HVEM can also bind to the inhibitory signaling protein, B- and T- lymphocyte attenuator (BTLA),which suppresses immune responses. Therefore, the HVEM network plays an important role in regulating immunity and the behavior of lymphocytes. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 0.1 μg/mL, measured by the neutralization assay using 929 cells in presence of 0.25 ng/mL of human TNF-beta, corresponding to a specific activity of > 1 × 10^4 units/mg. |
Molecular Mass : | ~45 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | LPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKRSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% by SDS-PAGE and HPLC analyses. |
Storage : | Lyophilized recombinant human HVEM-Fc (rhHVEM-Fc) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhHVEM-Fc remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O |
Gene Name | TNFRSF14 TNF receptor superfamily member 14 [ Homo sapiens (human) ] |
Official Symbol | TNFRSF14 |
Synonyms | TNFRSF14; TNF receptor superfamily member 14; TR2; ATAR; HVEA; HVEM; CD270; LIGHTR; tumor necrosis factor receptor superfamily member 14CD40-like proteinherpes virus entry mediator Atumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator)tumor necrosis factor receptor-like gene2 |
Gene ID | 8764 |
mRNA Refseq | NM_003820 |
Protein Refseq | NP_003811 |
MIM | 602746 |
UniProt ID | Q92956 |
◆ Recombinant Proteins | ||
TNFRSF14-756HAF555 | Recombinant Human TNFRSF14 Protein, Fc/His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
Tnfrsf14-428MAF555 | Recombinant Mouse Tnfrsf14 Protein, His-Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
TNFRSF14-442H | Recombinant Human TNFRSF14 Protein, His-tagged | +Inquiry |
Tnfrsf14-757MAF555 | Recombinant Mouse Tnfrsf14 Protein, Fc/His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
TNFRSF14-555HAF647 | Recombinant Human TNFRSF14 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF14-001MCL | Recombinant Mouse TNFRSF14 cell lysate | +Inquiry |
TNFRSF14-2155HCL | Recombinant Human TNFRSF14 cell lysate | +Inquiry |
TNFRSF14-2420MCL | Recombinant Mouse TNFRSF14 cell lysate | +Inquiry |
TNFRSF14-1133CCL | Recombinant Cynomolgus TNFRSF14 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF14 Products
Required fields are marked with *
My Review for All TNFRSF14 Products
Required fields are marked with *