Active Recombinant Human TNFRSF1A Protein
Cat.No. : | TNFRSF1A-203T |
Product Overview : | Recombinant Human TNFRSF1A Protein without tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Description : | TNF Receptor Type I, is also known as TNF R-p55/p60 and TNFRSF1A. It is a type I transmembrane protein member of the TNF receptor superfamily. It is expressed in most cell types. Binding of either TNF-α or TNF-β to TNF-R1 initiates a signal transduction pathway that results in the activation of the transcription factor NF-κB, whose target genes are involved in the regulation of inflammatory responses, and, in certain cells, induce apoptosis. TNF-R1 is essential for proper development of lymph node germinal centers and Peyer’s patches and for combating intracellular pathogens such as Listeria. It is stored in the Golgi and translocates to the cell surface following proinflammatory stimuli. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 50 ng/mL, measured in a cell proliferation assay using 929 cells in the presence of 1 ng/mL human TNF-α. |
Molecular Mass : | 28~35 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | DSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant Human TNF Receptor Type I remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human TNF Receptor Type I should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | TNFRSF1A tumor necrosis factor receptor superfamily, member 1A [ Homo sapiens ] |
Official Symbol | TNFRSF1A |
Synonyms | TNFRSF1A; tumor necrosis factor receptor superfamily, member 1A; TNFR1; tumor necrosis factor receptor superfamily member 1A; CD120a; TNF R; TNF R I; TNF R55; TNFAR; TNFR60; TNF-R1; TNF-RI; TNFR-I; tumor necrosis factor-alpha receptor; tumor necrosis factor receptor type 1; tumor necrosis factor binding protein 1; tumor necrosis factor receptor 1A isoform beta; FPF; p55; p60; TBP1; TNF-R; p55-R; TNFR55; TNF-R-I; TNF-R55; MGC19588; |
Gene ID | 7132 |
mRNA Refseq | NM_001065 |
Protein Refseq | NP_001056 |
MIM | 191190 |
UniProt ID | P19438 |
◆ Recombinant Proteins | ||
TNFRSF1A-65H | Active Recombinant Human TNFRSF1A protein, Fc-tagged | +Inquiry |
Tnfrsf1a-7051R | Recombinant Rat Tnfrsf1a protein, His-tagged | +Inquiry |
TNFRSF1A-237H | Recombinant Human TNFRSF1A Protein, His (Fc)-Avi-tagged | +Inquiry |
TNFRSF1A-445H | Recombinant Human TNFRSF1A Protein, His-tagged | +Inquiry |
TNFRSF1A-4172H | Recombinant Human Tumor Necrosis Factor Receptor Type 1, His Tag | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF1A-1693MCL | Recombinant Mouse TNFRSF1A cell lysate | +Inquiry |
TNFRSF1A-2390HCL | Recombinant Human TNFRSF1A cell lysate | +Inquiry |
TNFRSF1A-1084RCL | Recombinant Rat TNFRSF1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFRSF1A Products
Required fields are marked with *
My Review for All TNFRSF1A Products
Required fields are marked with *
0
Inquiry Basket