Active Recombinant Human TNFRSF1B Protein
Cat.No. : | TNFRSF1B-01H |
Product Overview : | Recombinant human TNFRSF1B protein without tag was expressed in E. coli. The TNFR2 is purified by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 24-206 a.a. |
Description : | The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein and TNF-receptor 1 form a heterocomplex that mediates the recruitment of two anti-apoptotic proteins, c-IAP1 and c-IAP2, which possess E3 ubiquitin ligase activity. The function of IAPs in TNF-receptor signalling is unknown, however, c-IAP1 is thought to potentiate TNF-induced apoptosis by the ubiquitination and degradation of TNF-receptor-associated factor 2, which mediates anti-apoptotic signals. Knockout studies in mice also suggest a role of this protein in protecting neurons from apoptosis by stimulating antioxidative pathways. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | The ED50 as determined by its ability to inhibit the TNF-a mediated cytotoxicity in the L-929 cells is less than 0.2 μg/mL, corresponding to a specific activity of > 5000 IU/mg in the presence of 0.25 ng/mL of rHuTNF-a. |
Molecular Mass : | 20 kDa |
AA Sequence : | MPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPT. |
Purity : | Greater than 97.0% as determined by SDS-PAGE. |
Stability : | Lyophilized TNFR2 although stable at room temperature for 3 weeks, should be stored desiccated below -18 centigrade. Upon reconstitution TNFR2 should be stored at 4 centigrade between 2-7 days and for future use below -18 centigrade. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized TNFR2 in sterile 18M-cm H2O not less than 100 μg/mL, which can then be further diluted to other aqueous solutions. |
Shipping : | Shipped at Room temp. |
Gene Name | TNFRSF1B TNF receptor superfamily member 1B [ Homo sapiens (human) ] |
Official Symbol | TNFRSF1B TNF receptor superfamily member 1B [ Homo sapiens (human) ] |
Synonyms | TNFRSF1B; TNF receptor superfamily member 1B; p75; TBPII; TNFBR; TNFR2; CD120b; TNFR1B; TNFR80; TNF-R75; p75TNFR; TNF-R-II; tumor necrosis factor receptor superfamily member 1B; TNF-R2; TNF-RII; p75 TNF receptor; p80 TNF-alpha receptor; tumor necrosis factor beta receptor; tumor necrosis factor binding protein 2; tumor necrosis factor receptor 2; tumor necrosis factor receptor type II |
Gene ID | 7133 |
mRNA Refseq | NM_001066 |
Protein Refseq | NP_001057 |
MIM | 191191 |
UniProt ID | P20333 |
◆ Recombinant Proteins | ||
Tnfrsf1b-3259M | Recombinant Mouse Tnfrsf1b protein(Met1-Gly258), hFc-tagged | +Inquiry |
TNFRSF1B-1482H | Recombinant Human TNFRSF1B Protein (Leu23-Asp257), N-His tagged | +Inquiry |
TNFRSF1B-31575TH | Recombinant Human TNFRSF1B, His-tagged | +Inquiry |
RFL26484MF | Recombinant Full Length Mouse Tumor Necrosis Factor Receptor Superfamily Member 1B(Tnfrsf1B) Protein, His-Tagged | +Inquiry |
TNFRSF1B-164H | Active Recombinant Human TNFRSF1B | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF1B-2632HCL | Recombinant Human TNFRSF1B cell lysate | +Inquiry |
TNFRSF1B-2192MCL | Recombinant Mouse TNFRSF1B cell lysate | +Inquiry |
TNFRSF1B-1048CCL | Recombinant Cynomolgus TNFRSF1B cell lysate | +Inquiry |
TNFRSF1B-851HCL | Recombinant Human TNFRSF1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF1B Products
Required fields are marked with *
My Review for All TNFRSF1B Products
Required fields are marked with *