| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
140-317 aa |
| Description : |
This gene encodes a member of the tumor necrosis factor (TNF) cytokine family which is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. This protein was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. This protein was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis. Targeted disruption of the related gene in mice led to severe osteopetrosis and a lack of osteoclasts. The deficient mice exhibited defects in early differentiation of T and B lymphocytes, and failed to form lobulo-alveolar mammary structures during pregnancy. Two alternatively spliced transcript variants have been found. |
| Tag : |
N-His |
| Form : |
Liquid |
| Bio-activity : |
Measured by its ability to induce osteoclast differentiation of RAW 264.7 mouse monocyte/macrophage cells. The ED50 range ≤ 25 ng/mL. |
| Molecular Mass : |
22.3 kDa |
| AA Sequence : |
< MGSSHHHHHHSSGLVPRGSHM> IRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID |
| Endotoxin : |
< 1 EU/μg of protein determined by LAL method |
| Purity : |
> 85% by SDS-PAGE |
| Applications : |
SDS-PAGE, Bioactivity |
| Storage : |
Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 or -70 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : |
0.5 mg/mL (determined by Bradford assay) |
| Storage Buffer : |
20mM Tris-HCl buffer (pH 8.0) containing 20% glycerol, 0.1M NaCl, 1mM DTT |
| References : |
1. Lam J., et al. (2001) J. Clin. Invest. 108:971-979 Ito S., et al. (2002) J. Biol. Chem. 277:6631-6636 |
