Active Recombinant Human TNFSF18 Protein (126 aa)

• Cat.No.: TNFSF18-442T
• Product Overview: Recombinant human Activation-Inducible TNF-Related Ligand (rhAITRL) produced in E. coli is a single non-glycosylated polypeptide chain containing 126 amino acids. A fully biologically active molecule, rhAITRL has a molecular mass of 14.3 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 126
• Description: Activation-Inducible TNF-Related Ligand (AITRL), also known as Glucocorticoid-Induced TNF-Related Ligand (GITRL), belongs to the tumor necrosis factor superfamily (TNFSF). AITRL is a Type II single transmembrane protein and shares low conservation within the extracellular domain with other TNFSF members. AITRL is expressed on macrophages, immature and mature dendritic cells and B cells. Its receptor, Activation-Inducible TNFR family Receptor (AITR), is expressed on T lymphocytes, natural killer (NK) cells, and antigen-presenting cells. Upon binding by AITRL, AITR can be released. AITR activation increases resistance to tumors and viral infections and is involved in autoimmune and inflammatory processes. In addition, activated AITR increases TCR-induced T cell proliferation and cytokine production and rescues T cells and NK cells from apoptosis.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 5 ng/mL, measured by the amount of Interleukin-8 produced by PMBC, corresponding to a specific activity of > 2.0 × 10^5 units/mg.
• Molecular Mass: 14.3 kDa, observed by reducing SDS-PAGE.
• AA Sequence: METAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFI
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE analysis.
• Storage: Lyophilized recombinant human Activation-Inducible TNF-Related Ligand (rhAITRL) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhAITRL remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against 50 mM Tris, pH8.0.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: TNFSF18 tumor necrosis factor (ligand) superfamily, member 18 [ Homo sapiens ]
• Official Symbol: TNFSF18
• Synonyms: TNFSF18; tumor necrosis factor (ligand) superfamily, member 18; tumor necrosis factor ligand superfamily member 18; AITRL; hGITRL; TL6; AITR ligand; GITR ligand; activation-inducible TNF-related ligand; glucocorticoid-induced TNF-related ligand; glucocorticoid-induced TNFR-related protein ligand; GITRL; MGC138237
• Gene ID: 8995
• mRNA Refseq: NM_005092
• Protein Refseq: NP_005083
• MIM: 603898
• UniProt ID: Q9UNG2