Active Recombinant Mouse Tnfsf18 Protein (127 aa)
Cat.No. : | Tnfsf18-441T |
Product Overview : | Recombinant mouse Activation-Inducible TNF-Related Ligand (rmAITRL) produced in E. coli is a single non-glycosylated polypeptide chain containing 127 amino acids. A fully biologically active molecule, rmAITRL has a molecular mass of 14.5 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Protein Length : | 127 |
Description : | Activation-Inducible TNF-Related Ligand (AITRL), also known as Glucocorticoid-Induced TNF-Related Ligand (GITRL), belongs to the tumor necrosis factor superfamily (TNFSF). AITRL is a Type II single transmembrane protein and shares low conservation within the extracellular domain with other TNFSF members. AITRL is expressed on macrophages, immature and mature dendritic cells and B cells. Its receptor, Activation-Inducible TNFR family Receptor (AITR), is expressed on T lymphocytes, natural killer (NK) cells, and antigen-presenting cells. After binding by AITRL, AITR can be released. AITR activation increases resistance to tumors and viral infections and is involved in autoimmune and inflammatory processes. In addition, activated AITR increases TCR-induced T cell proliferation and cytokine production and rescues T cells and NK cells from apoptosis. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 5 ng/mL, measured by the amount of Interleukin-8 produced by PMBC, corresponding to a specific activity of > 2.0 × 10^5 units/mg. |
Molecular Mass : | 14.5 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | TAIESCMVKFELSSSKWHMTSPKPHCVNTTSDGKLKILQSGTYLIYGQVIPVDKKYIKDNAPFVVQIYKKNDVLQTLMNDFQILPIGGVYELHAGDNIYLKFNSKDHIQKTNTYWGIILMPDLPFIS |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% by SDS-PAGE and HPLC analyses. |
Storage : | Lyophilized recombinant mouse Activation-Inducible TNF-Related Ligand (rmAITRL) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmAITRL remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | Tnfsf18 tumor necrosis factor (ligand) superfamily, member 18 [ Mus musculus ] |
Official Symbol | Tnfsf18 |
Synonyms | TNFSF18; tumor necrosis factor (ligand) superfamily, member 18; tumor necrosis factor ligand superfamily member 18; GITR ligand; glucocorticoid-induced TNF-related ligand; glucocorticoid-induced-tumor necrosis factor receptor ligand; Gitrl; |
Gene ID | 240873 |
mRNA Refseq | NM_183391 |
Protein Refseq | NP_899247 |
UniProt ID | Q7TS55 |
◆ Recombinant Proteins | ||
TNFSF18-882H | Recombinant Human TNFSF18 Protein, His-tagged | +Inquiry |
TNFSF18-30483TH | Recombinant Human TNFSF18 protein | +Inquiry |
Tnfsf18-408M | Active Recombinant Mouse Tnfsf18, His-tagged | +Inquiry |
TNFSF18-104H | Recombinant Human TNFSF18 Protein, Gln50-Ser177, N-His-Flag tagged, Biotinylated | +Inquiry |
Tnfsf18-15M | Active Recombinant Mouse Tnfsf18 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF18-890HCL | Recombinant Human TNFSF18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tnfsf18 Products
Required fields are marked with *
My Review for All Tnfsf18 Products
Required fields are marked with *
0
Inquiry Basket