Active Recombinant Human VEGFC Protein (126 aa)
Cat.No. : | VEGFC-160V |
Product Overview : | Recombinant human VEGF-C produced in HEK293 cells is a polypeptide chain containing 126 amino acids. A fully biologically active molecule, rhVEGF-C has a molecular mass of 16-19 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Protein Length : | 126 |
Description : | Vascular endothelial growth factor C (VEGF-C) is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family, is active in angiogenesis, lymphangiogenesis and endothelial cell growth and survival, and can also affect the permeability of blood vessels. VEGF-C is expressed in various tissues, however it is not produced in peripheral blood lymphocytes. It forms cell surface-associated non-covalent disulfide linked homodimers, and can bind and activate both VEGFR-2 (flk1) and VEGFR-3 (flt4) receptors. The structure and function of VEGF-C is similar to those of vascular endothelial growth factor D (VEGF-D). |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Measured in a cell proliferation assay using HMVEC human microvascular endothelial cells. The ED50 for this effect is < 0.5 μg/mL. |
Molecular Mass : | 16~19 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | MAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant Human Vascular Endothelial Growth Factor C remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Vascular Endothelial Growth Factor C should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | VEGFC vascular endothelial growth factor C [ Homo sapiens ] |
Official Symbol | VEGFC |
Synonyms | VEGFC; vascular endothelial growth factor C; VRP; VEGF-C; FLT4 ligand DHM; vascular endothelial growth factor-related protein; Flt4-L; |
Gene ID | 7424 |
mRNA Refseq | NM_005429 |
Protein Refseq | NP_005420 |
MIM | 601528 |
UniProt ID | P49767 |
◆ Recombinant Proteins | ||
Vegfc-635R | Recombinant Rat Vascular Endothelial Growth Factor C, His-tagged | +Inquiry |
VEGFC-6559H | Recombinant Human VEGFC Protein (Phe32-Arg227), C-His tagged | +Inquiry |
VEGFC-566H | Recombinant Human VEGFC Protein, His-tagged | +Inquiry |
VEGFC-607R | Recombinant Rabbit VEGFC protein, His & GST-tagged | +Inquiry |
VEGFC-160V | Active Recombinant Human VEGFC Protein (126 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
VEGFC-1306RCL | Recombinant Rat VEGFC cell lysate | +Inquiry |
VEGFC-2768HCL | Recombinant Human VEGFC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VEGFC Products
Required fields are marked with *
My Review for All VEGFC Products
Required fields are marked with *
0
Inquiry Basket