Active Recombinant Human VEGFC Protein (126 aa)

• Cat.No.: VEGFC-160V
• Product Overview: Recombinant human VEGF-C produced in HEK293 cells is a polypeptide chain containing 126 amino acids. A fully biologically active molecule, rhVEGF-C has a molecular mass of 16-19 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.

Specification

• Species: Human
• Source: HEK293
• Protein Length: 126
• Description: Vascular endothelial growth factor C (VEGF-C) is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family, is active in angiogenesis, lymphangiogenesis and endothelial cell growth and survival, and can also affect the permeability of blood vessels. VEGF-C is expressed in various tissues, however it is not produced in peripheral blood lymphocytes. It forms cell surface-associated non-covalent disulfide linked homodimers, and can bind and activate both VEGFR-2 (flk1) and VEGFR-3 (flt4) receptors. The structure and function of VEGF-C is similar to those of vascular endothelial growth factor D (VEGF-D).
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Measured in a cell proliferation assay using HMVEC human microvascular endothelial cells. The ED50 for this effect is < 0.5 μg/mL.
• Molecular Mass: 16~19 kDa, observed by reducing SDS-PAGE.
• AA Sequence: MAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant Human Vascular Endothelial Growth Factor C remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Vascular Endothelial Growth Factor C should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: VEGFC vascular endothelial growth factor C [ Homo sapiens ]
• Official Symbol: VEGFC
• Synonyms: VEGFC; vascular endothelial growth factor C; VRP; VEGF-C; FLT4 ligand DHM; vascular endothelial growth factor-related protein; Flt4-L
• Gene ID: 7424
• mRNA Refseq: NM_005429
• Protein Refseq: NP_005420
• MIM: 601528
• UniProt ID: P49767