Recombinant Human VEGFC protein, His-tagged
| Cat.No. : | VEGFC-5743H | 
| Product Overview : | Recombinant Human VEGFC protein(P49767)(32-419aa), fused with C-terminal His tag, was expressed in Insect cells. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Insect cells | 
| Tag : | His | 
| Protein Length : | 32-419aa | 
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. | 
| Molecular Mass : | 45.5 kDa | 
| Purity : | Greater than 85% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. | 
| AA Sequence : | FESGLDLSDAEPDAGEATAYASKDLEEQLRSVSSVDELMTVLYPEYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRSLPATLPQCQAANKTCPTNYMWNNHICRCLAQEDFMFSSDAGDDSTDGFHDICGPNKELDEETCQCVCRAGLRPASCGPHKELDRNSCQCVCKNKLFPSQCGANREFDENTCQCVCKRTCPRNQPLNPGKCACECTESPQKCLLKGKKFHHQTCSCYRRPCTNRQKACEPGFSYSEEVCRCVPSYWKRPQMS | 
| Gene Name | VEGFC vascular endothelial growth factor C [ Homo sapiens ] | 
| Official Symbol | VEGFC | 
| Synonyms | VEGFC; vascular endothelial growth factor C; VRP; VEGF-C; FLT4 ligand DHM; vascular endothelial growth factor-related protein; Flt4-L; | 
| Gene ID | 7424 | 
| mRNA Refseq | NM_005429 | 
| Protein Refseq | NP_005420 | 
| MIM | 601528 | 
| UniProt ID | P49767 | 
| ◆ Recombinant Proteins | ||
| VEGFC-615H | Recombinant Human Vascular Endothelial Growth Factor C, His-tagged | +Inquiry | 
| VEGFC-10009M | Recombinant Mouse VEGFC Protein, His (Fc)-Avi-tagged | +Inquiry | 
| Vegfc-5536R | Active Recombinant Rat Vegfc 152S Mutant Protein | +Inquiry | 
| VEGFC-133H | Active Recombinant Human VEGFC Protein, His-tagged | +Inquiry | 
| VEGFC-607R | Recombinant Rabbit VEGFC protein, His & GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| VEGFC-2768HCL | Recombinant Human VEGFC cell lysate | +Inquiry | 
| VEGFC-1306RCL | Recombinant Rat VEGFC cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VEGFC Products
Required fields are marked with *
My Review for All VEGFC Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            