Active Recombinant Mouse Adipoq Protein

Cat.No. : Adipoq-034M
Product Overview : Purified recombinant protein of Mouse adiponectin, C1Q and collagen domain containing (Adipoq) without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW.
Bio-activity : Determined by its ability to inhibit the proliferation of murine myeloid cell lines M1. ED50 for this effect is less than or equal to 15 ug/ml.
Molecular Mass : 16.6 kDa
AA Sequence : MKGEPGEAAYMYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer.
Gene Name Adipoq adiponectin, C1Q and collagen domain containing [ Mus musculus (house mouse) ]
Official Symbol Adipoq
Synonyms Adipoq; adiponectin, C1Q and collagen domain containing; Ad; APN; Acdc; Adid; apM1; 30kDa; GBP28; adipo; Acrp30; adiponectin; 30 kDa adipocyte complement-related protein; adipocyte complement related protein; adipocyte complement-related 30 kDa protein; adipocyte, C1Q and collagen domain containing; adipocyte, C1q and collagen domain-containing protein; adipocyte-specific protein AdipoQ; adiponectin d
Gene ID 11450
mRNA Refseq NM_009605
Protein Refseq NP_033735
UniProt ID Q60994

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Adipoq Products

Required fields are marked with *

My Review for All Adipoq Products

Required fields are marked with *

0
cart-icon