Active Recombinant Mouse Ccl11 Protein (74 aa)
Cat.No. : | Ccl11-035C |
Product Overview : | Recombinant Mouse Ccl11 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Protein Length : | 74 |
Description : | Eotaxin also called CCL11 is a CC chemokine that signals through the CCR3 receptor. It is produced by IFN-gamma stimulated endothelial cells and TNF-activated monocytes. Eotaxin selectively chemoattracts eosinophils and along Eotaxin-2 and Eotaxin-3, plays a key role in the regulation of eosinophil recruitment in the asthmatic lung, and in allergic reactions. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Measured by its ability to chemoattract mouse CCR3 transfected BaF3 mouse proB cells. The ED50 for this effect is typically 1-5 ng/mL. |
Molecular Mass : | Approximately 8.3 kDa, a single non-glycosylated polypeptide chain containing 74 amino acids. |
AA Sequence : | HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP |
Endotoxin : | Less than 1 EU/μg of rMuEotaxin/CCL11 as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Ccl11 chemokine (C-C motif) ligand 11 [ Mus musculus ] |
Official Symbol | Ccl11 |
Synonyms | CCL11; chemokine (C-C motif) ligand 11; eotaxin; C-C motif chemokine 11; small inducible cytokine A11; small-inducible cytokine A11; eosinophil chemotactic protein; small chemokine (C-C motif) ligand 11; Scya11; |
Gene ID | 20292 |
mRNA Refseq | NM_011330 |
Protein Refseq | NP_035460 |
UniProt ID | P48298 |
◆ Recombinant Proteins | ||
CCL11-27H | Recombinant Human Chemokine (C-C motif) ligand 11,His-tagged | +Inquiry |
CCL11-4377R | Recombinant Rabbit CCL11 Protein | +Inquiry |
CCL11-172H | Active Recombinant Human CCL11 | +Inquiry |
CCL11-1430H | Recombinant Human CCL11 Protein (Gly24-Pro97), N-GST tagged | +Inquiry |
Ccl11-4329M | Recombinant Mouse Ccl11 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL11-7735HCL | Recombinant Human CCL11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ccl11 Products
Required fields are marked with *
My Review for All Ccl11 Products
Required fields are marked with *
0
Inquiry Basket