Species : |
Mouse |
Source : |
E.coli |
Protein Length : |
74 |
Description : |
Eotaxin also called CCL11 is a CC chemokine that signals through the CCR3 receptor. It is produced by IFN-gamma stimulated endothelial cells and TNF-activated monocytes. Eotaxin selectively chemoattracts eosinophils and along Eotaxin-2 and Eotaxin-3, plays a key role in the regulation of eosinophil recruitment in the asthmatic lung, and in allergic reactions. |
Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : |
Measured by its ability to chemoattract mouse CCR3 transfected BaF3 mouse proB cells. The ED50 for this effect is typically 1-5 ng/mL. |
Molecular Mass : |
Approximately 8.3 kDa, a single non-glycosylated polypeptide chain containing 74 amino acids. |
AA Sequence : |
HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP |
Endotoxin : |
Less than 1 EU/μg of rMuEotaxin/CCL11 as determined by LAL method. |
Purity : |
>95% by SDS-PAGE and HPLC analyses. |
Storage : |
This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : |
Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |