Active Recombinant Mouse CCL2 Protein

Cat.No. : CCL2-15M
Product Overview : Recombinant Mouse CCL2 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Monocyte chemotactic protein 1 (MCP-1), also known as CCL2, is produced by injured or infected tissues. MCP-1 signals through the CCR2 and CCR4 G protein-coupled receptors to recruit memory T cells, monocytes, and dendritic cells to sites of inflammation.
Bio-activity : THP-1 chemotaxis, ≤100 ng/mL
Molecular Mass : Monomer, 13.8 kDa (125 aa)
AA Sequence : QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name Ccl2 chemokine (C-C motif) ligand 2 [ Mus musculus (house mouse) ]
Official Symbol CCL2
Synonyms CCL2; chemokine (C-C motif) ligand 2; C-C motif chemokine 2; small inducible cytokine A2; small-inducible cytokine A2; monocyte chemotactic protein 1; monocyte chemoattractant protein 1; monocyte chemoattractant protein-1; platelet-derived growth factor-inducible protein JE; JE; HC11; MCAF; MCP1; MCP-1; Scya2; Sigje; SMC-CF; AI323594;
Gene ID 20296
mRNA Refseq NM_011333
Protein Refseq NP_035463
UniProt ID P10148

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL2 Products

Required fields are marked with *

My Review for All CCL2 Products

Required fields are marked with *

0
cart-icon