Active Recombinant Mouse Csf2 Protein
Cat.No. : | Csf2-045M |
Product Overview : | Purified recombinant protein of Mouse colony stimulating factor 2 (granulocyte-macrophage) (Csf2) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. |
Bio-activity : | The ED50 as determined by the dose-dependent stimulation of the proliferation of murine FDC-P1 cells is less than or equal to 0.05 ng/ml, corresponding to a specific activity of > 2 x 10^7 units/mg. |
Molecular Mass : | 14.2 kDa |
AA Sequence : | MAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Csf2 colony stimulating factor 2 (granulocyte-macrophage) [ Mus musculus (house mouse) ] |
Official Symbol | Csf2 |
Synonyms | Csf2; colony stimulating factor 2 (granulocyte-macrophage); CSF; Csfgm; GMCSF; Gm-CSf; MGI-IGM; granulocyte-macrophage colony-stimulating factor; colony-stimulating factor; granulocyte-macrophage colony stimulating factor 2; put. GM-CSF |
Gene ID | 12981 |
mRNA Refseq | NM_009969 |
Protein Refseq | NP_034099 |
UniProt ID | P01587 |
◆ Recombinant Proteins | ||
Csf2-044M | Recombinant Mouse Csf2 Protein | +Inquiry |
CSF2-486H | Recombinant Human CSF2 protein(Ala18-Glu144), hFc-tagged | +Inquiry |
CSF2-392C | Active Recombinant Human CSF2 Protein | +Inquiry |
CSF2-2522H | Recombinant Human CSF2 Protein (Ala18-Glu144), C-His tagged | +Inquiry |
CSF2-28H | Active Recombinant Human CSF2 Protein (Ala18-Glu144), N-His tagged, Animal-free, Carrier-free | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF2-3008HCL | Recombinant Human CSF2 cell lysate | +Inquiry |
CSF2-1008MCL | Recombinant Mouse CSF2 cell lysate | +Inquiry |
CSF2-740RCL | Recombinant Rat CSF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Csf2 Products
Required fields are marked with *
My Review for All Csf2 Products
Required fields are marked with *