Active Recombinant Mouse Csf2 Protein

Cat.No. : Csf2-045M
Product Overview : Purified recombinant protein of Mouse colony stimulating factor 2 (granulocyte-macrophage) (Csf2) without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.
Bio-activity : The ED50 as determined by the dose-dependent stimulation of the proliferation of murine FDC-P1 cells is less than or equal to 0.05 ng/ml, corresponding to a specific activity of > 2 x 10^7 units/mg.
Molecular Mass : 14.2 kDa
AA Sequence : MAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer.
Gene Name Csf2 colony stimulating factor 2 (granulocyte-macrophage) [ Mus musculus (house mouse) ]
Official Symbol Csf2
Synonyms Csf2; colony stimulating factor 2 (granulocyte-macrophage); CSF; Csfgm; GMCSF; Gm-CSf; MGI-IGM; granulocyte-macrophage colony-stimulating factor; colony-stimulating factor; granulocyte-macrophage colony stimulating factor 2; put. GM-CSF
Gene ID 12981
mRNA Refseq NM_009969
Protein Refseq NP_034099
UniProt ID P01587

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Csf2 Products

Required fields are marked with *

My Review for All Csf2 Products

Required fields are marked with *

0
cart-icon