Active Recombinant Mouse IL10 Protein

Cat.No. : IL10-128M
Product Overview : Recombinant Mouse IL10 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Interleukin 10 (IL-10) is an anti-inflammatory cytokine produced by macrophages and type 2 T helper (Th2) cells. IL-10 inhibits the production of pro-inflammatory cytokines such as interferon gamma (IFN´), tumor necrosis factor alpha (TNFα), interleukin 2 (IL-2), interleukin 3 (IL-3), interleukin 4 (IL-4), and granulocyte-macrophage colony-stimulating factor (GM-CSF), made by macrophages and regulatory T cells. IL-10 also suppresses antigen presentation on antigen presenting cells, and enhances the survival, proliferation, and antibody production of B cells. Mouse IL-10 is not active on human cells.
Bio-activity : MC/9 cell proliferation, ≤5 ng/mL
Molecular Mass : Noncovalent homodimer, 18.9 kDa (161 aa)
AA Sequence : MSRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name Il10 interleukin 10 [ Mus musculus (house mouse) ]
Official Symbol IL10
Synonyms IL10; interleukin 10; interleukin-10; cytokine synthesis inhibitory factor; CSIF; Il-10;
Gene ID 16153
mRNA Refseq NM_010548
Protein Refseq NP_034678
UniProt ID P18893

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL10 Products

Required fields are marked with *

My Review for All IL10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon