Active Recombinant Mouse Il15 Protein, His-tagged
Cat.No. : | Il15-7234M |
Product Overview : | Recombinant mouse IL-15, His-tagged, was expressed in E. coli and purified by using conventional chromatography after refolding of the isolated inclusion bodies in a redox buffer. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes a a pleiotropic cytokine of the interleukin family of proteins that plays important roles in the innate and adaptive cell homeostasis, as well as peripheral immune function. The encoded protein undergoes proteolytic processing to generate a mature cytokine that stimulates the proliferation of natural killer cells. The transgenic mice overexpressing the encoded protein exhibit an increase in the number of memory CD8+ T cells in a naive state and enhanced protection against bacterial infections. Mice lacking the encoded protein exhibit impaired protection against a strain of attenuated Mycobacterium. |
Form : | Liquid |
Bio-activity : | Measured in a cell proliferation assay using CTLL2 mouse cytotoxicT cells. The ED50 for this effect is < 1 ng/mL. Activity Assay 1. Cell line: CTLL2 (mouse cytotoxic T cell) 2. Maintenance Condition: 10% FBS RPMI 1640 with hIL2 3. Assay Medium: 10% FBS RPMI 1640 without hIL2 4. Cell Density: 2 x 10^4 cells/well (96 well plate, final volume 100 μL) 5. Starvation: 24 hr, Assay medium 6. Incubation Time: 24hr (after sample treatment) 7. Concentration Range: 0.039 ng/mL - 40 ng/mL 8. Detection method: MTT assay |
Molecular Mass : | 17.6 kDa |
AA Sequence : | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMNWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS |
Endotoxin : | < 1.0 EU/μg of protein (determined by LAL method) |
Purity : | > 90 % by SDS-PAGE |
Concentration : | 0.5 mg/mL (determined by Bradford assay) |
Storage Buffer : | PBS, pH 7.4, containing 10 % glycerol |
Gene Name | Il15 interleukin 15 [ Mus musculus (house mouse) ] |
Official Symbol | Il15 |
Synonyms | Il15; interleukin 15; IL-15; AI503618; interleukin-15 |
Gene ID | 16168 |
mRNA Refseq | NM_001254747 |
Protein Refseq | NP_001241676 |
UniProt ID | P48346 |
◆ Recombinant Proteins | ||
IL15-151H | Recombinant Human IL15 Protein, DYKDDDDK-tagged | +Inquiry |
IL15-3624Z | Recombinant Zebrafish IL15 | +Inquiry |
IL15-2291G | Recombinant Goat IL15 Protein, His-tagged | +Inquiry |
IL15-2053R | Recombinant Rhesus Macaque IL15 Protein, His (Fc)-Avi-tagged | +Inquiry |
IL15-063H | Active Recombinant Human IL15 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL15-5248HCL | Recombinant Human IL15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il15 Products
Required fields are marked with *
My Review for All Il15 Products
Required fields are marked with *
0
Inquiry Basket