Active Recombinant Mouse Il15 Protein, His-tagged

Cat.No. : Il15-7234M
Product Overview : Recombinant mouse IL-15, His-tagged, was expressed in E. coli and purified by using conventional chromatography after refolding of the isolated inclusion bodies in a redox buffer.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : This gene encodes a a pleiotropic cytokine of the interleukin family of proteins that plays important roles in the innate and adaptive cell homeostasis, as well as peripheral immune function. The encoded protein undergoes proteolytic processing to generate a mature cytokine that stimulates the proliferation of natural killer cells. The transgenic mice overexpressing the encoded protein exhibit an increase in the number of memory CD8+ T cells in a naive state and enhanced protection against bacterial infections. Mice lacking the encoded protein exhibit impaired protection against a strain of attenuated Mycobacterium.
Form : Liquid
Bio-activity : Measured in a cell proliferation assay using CTLL2 mouse cytotoxicT cells. The ED50 for this effect is < 1 ng/mL.
Activity Assay
1. Cell line: CTLL2 (mouse cytotoxic T cell)
2. Maintenance Condition: 10% FBS RPMI 1640 with hIL2
3. Assay Medium: 10% FBS RPMI 1640 without hIL2
4. Cell Density: 2 x 10^4 cells/well (96 well plate, final volume 100 μL)
5. Starvation: 24 hr, Assay medium
6. Incubation Time: 24hr (after sample treatment)
7. Concentration Range: 0.039 ng/mL - 40 ng/mL
8. Detection method: MTT assay
Molecular Mass : 17.6 kDa
AA Sequence : MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMNWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS
Endotoxin : < 1.0 EU/μg of protein (determined by LAL method)
Purity : > 90 % by SDS-PAGE
Concentration : 0.5 mg/mL (determined by Bradford assay)
Storage Buffer : PBS, pH 7.4, containing 10 % glycerol
Gene Name Il15 interleukin 15 [ Mus musculus (house mouse) ]
Official Symbol Il15
Synonyms Il15; interleukin 15; IL-15; AI503618; interleukin-15
Gene ID 16168
mRNA Refseq NM_001254747
Protein Refseq NP_001241676
UniProt ID P48346

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il15 Products

Required fields are marked with *

My Review for All Il15 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon