Active Recombinant Mouse Il1b Protein

Cat.No. : Il1b-632M
Product Overview : Recombinant Mouse Il1b Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Description : Interleukin-1beta (IL-1β) is a non-secreted proinflammatory cytokine produced mainly by activated macrophages, as well as neutrophils, epithelial cells, and endothelial cells. It possesses metabolic, physiological, haematopoietic activities, and plays one of the central roles in the regulation of the immune responses. Both IL-1α and IL-1β binds to the same receptor and has similar but not identical biological properties. The mature mouse IL1β shares 90 % amino acid sequence identity with cotton rat and rat and 65 %-78 % identity with canine, human and rhesus IL1β.
Form : Sterile Filtered White lyophil
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 2 pg/mL, corresponding to a specific activity of > 5.0×10^8 IU/mg.
Molecular Mass : Approximately 17.5 kDa
AA Sequence : VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS
Endotoxin : Less than 1 EU/μg of rMuIL-1a as determined by LAL method.
Purity : > 96% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze thaw cycles.
Storage Buffer : Lyophilized from a 0.2 μm filtered solution in PBS, pH 7.4, with 5 % trehalose, 0.02 % Tween-20.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL.
Gene Name Il1b interleukin 1 beta [ Mus musculus (house mouse) ]
Official Symbol Il1b
Synonyms IL1B; interleukin 1 beta; interleukin-1 beta; IL-1 beta; Il-1b; IL-1beta;
Gene ID 16176
mRNA Refseq NM_008361
Protein Refseq NP_032387
UniProt ID P10749

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il1b Products

Required fields are marked with *

My Review for All Il1b Products

Required fields are marked with *

0

Inquiry Basket

cartIcon