Active Recombinant Mouse Osm Protein

Cat.No. : Osm-168O
Product Overview : Recombinant Mouse Osm Protein without tag was expressed in HEK 293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Description : Oncostatin-M, also known as OSM, is a growth regulator belonging to the interleukin-6 group of cytokines. It is expressed mainly by monocytes, activated T cells and Kaposi’s sarcoma cells. OSM signals through two types of receptors; one is composed of gp130 and LIFR, and the other is composed of gp130 and OSMR. OSM regulates IL-6, G-CSF and GM-CSF production, and thus is involved in hematopoiesis, neurogenesis and osteogenesis. OSM displays both stimulatory and inhibitory effects, so its categorization as pro-inflammatory or anti-inflammatory cytokine is still controversial.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 0.4 ng/mL, measured in a cell proliferation assay using NIH-3T3 cells.
Molecular Mass : 10-40 kDa, observed by reducing SDS-PAGE.
AA Sequence : ANRGCSNSSSQLLSQLQNQANLTGNTESLLEPYIRLQNLNTPDLRAACTQHSVAFPSEDTLRQLSKPHFLSTVYTTLDRVLYQLDALRQKFLKTPAFPKLDSARHNILGIRNNVFCMARLLNHSLEIPEPTQTDSGASRSTTTPDVFNTKIGSCGFLWGYHRFMGSVGRVFREWDDGSTRSRR
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant Murine Oncostatin-M remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Murine Oncostatin-M should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name Osm oncostatin M [ Mus musculus ]
Official Symbol Osm
Synonyms OSM; oncostatin M; oncostatin-M; OncoM;
Gene ID 18413
mRNA Refseq NM_001013365
Protein Refseq NP_001013383
UniProt ID P53347

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Osm Products

Required fields are marked with *

My Review for All Osm Products

Required fields are marked with *

0
cart-icon