Recombinant Rhesus Monkey OSM Protein, His tagged

Cat.No. : Osm-3256R
Product Overview : Recombinant Rhesus Monkey OSM Protein with His tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rhesus Monkey
Source : HEK293
Tag : His
Protein Length : 22-252 aa
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile 20mM Tris, 0.5M NaCl, 50% Glycerol, pH8.0
AA Sequence : MASMAAMGSCSKEYRMLLGQLQKQTDLMQDTSRLLDPYIRIQGLDIPKLREHCRESPGAFPSEETLRGLGRRGFLQTLNATLGRVLHRLADLEQHLPKAQDLERSGLNIEDLEKLQMARPNVLGLRNNVYCMAQLLDNSDMTEPTKAGRGTPQPPTPTPTSDVFQRKLEGCSFLRGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGNRLMPRGQLPRHHHHHHHH
Endotoxin : <1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Concentration : 0.6 mg/mL by BCA
Official Symbol OSM
Synonyms OSM; oncostatin M; oncostatin-M
Gene ID 717994
mRNA Refseq NM_001194474
Protein Refseq NP_001181403
UniProt ID F7GF43

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OSM Products

Required fields are marked with *

My Review for All OSM Products

Required fields are marked with *

0
cart-icon