Recombinant Rhesus Monkey OSM Protein, His tagged

• Cat.No.: Osm-3256R
• Product Overview: Recombinant Rhesus Monkey OSM Protein with His tag was expressed in HEK293.

Specification

• Species: Rhesus Monkey
• Source: HEK293
• Tag: His
• Protein Length: 22-252 aa
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile 20mM Tris, 0.5M NaCl, 50% Glycerol, pH8.0
• AA Sequence: MASMAAMGSCSKEYRMLLGQLQKQTDLMQDTSRLLDPYIRIQGLDIPKLREHCRESPGAFPSEETLRGLGRRGFLQTLNATLGRVLHRLADLEQHLPKAQDLERSGLNIEDLEKLQMARPNVLGLRNNVYCMAQLLDNSDMTEPTKAGRGTPQPPTPTPTSDVFQRKLEGCSFLRGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGNRLMPRGQLPRHHHHHHHH
• Endotoxin: <1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Concentration: 0.6 mg/mL by BCA

Gene Information

• Official Symbol: OSM
• Synonyms: OSM; oncostatin M; oncostatin-M
• Gene ID: 717994
• mRNA Refseq: NM_001194474
• Protein Refseq: NP_001181403
• UniProt ID: F7GF43