Active Recombinant Mouse Prdx1 Protein, His-tagged

Cat.No. : Prdx1-7295M
Product Overview : Recombinant Mouse Prdx1 Protein with a His tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Tag : His
Description : Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2. Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation.
Form : Liquid
Bio-activity : Specific activity is >2,500 pmol/min/μg. Enzymatic activity is defined as the amount of hydroperoxide that 1 μg of enzyme can reduce at 25 centigrade for minute.
Molecular Mass : 23.2 kDa
AA Sequence : MSSGNAKIGYPAPNFKATAVMPDGQFKDISLSEYKGKYVVFFFYPLDFTFVCPTEIIAFSDRADEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLISDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEIIRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVNKSKEYFSKQKLEHHHHHH
Endotoxin : < 1.0 EU/μg of protein (determined by LAL method)
Purity : > 90 % by SDS-PAGE
Concentration : 0.5 mg/mL (determined by absorbance at 280nm)
Storage Buffer : Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol.
Gene Name Prdx1 peroxiredoxin 1 [ Mus musculus (house mouse) ]
Official Symbol Prdx1
Synonyms Prdx1; peroxiredoxin 1; P; pr; MSP; OSF; PAG; OSF3; Paga; PrxI; TDX2; TPxA; Tdpx; prx1; MSP23; NkefA; OSF-3; PrdxI; Tdpx2; peroxiredoxin-1; Trx dependent peroxide reductase 2; macrophage 23 Kd stress protein; macrophage 23 kDa stress protein; macrophage 23kDa stress protein; macrophase stress protein 22kDa; macrophase stress protein 23 kd; osteoblast-specific factor 3; proliferation-associated gene A; thioredoxin peroxidase 2; thioredoxin-dependent peroxide reductase 2; thioredoxin-dependent peroxiredoxin 1; EC 1.11.1.24
Gene ID 18477
mRNA Refseq NM_011034
Protein Refseq NP_035164
UniProt ID P35700

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Prdx1 Products

Required fields are marked with *

My Review for All Prdx1 Products

Required fields are marked with *

0
cart-icon