Species : |
Rat |
Source : |
E.coli |
Protein Length : |
194 |
Description : |
Granulocyte Colony-Stimulating Factor (G-CSF) is a hematopoietic cytokine belonging to the four-helix bundle cytokine superfamily. G-CSF is produced by monocytes, macrophages, fibroblasts, and endothelial cells. Its expression is highly regulated and induced by a variety of agents, including Tumor Necrosis Factor (TNF), Interleukin-1 (IL-1), Interferon γ (IFN-γ), and Granulocyte-Macrophage Colony-Stimulating Factor (GM-CSF). G-CSF binds to the CSF-specific high affinity receptors expressed on neutrophilic granulocyte lineage. In vivo G-CSF regulates the production of neutrophilic granulocytes, a critical part of host defense systems, and helps the maturation of leukemic cell lines. G-CSF is widely employed clinically because of its fairly innocuous safety profile. |
Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : |
ED50 < 0.1 ng/mL, measured by a cell proliferation assay using NSF-60 cells, corresponding to a specific activity of > 1 × 10^7 units/mg. |
Molecular Mass : |
21.4 kDa, observed by non-reducing SDS-PAGE. |
AA Sequence : |
MIPLLTVSSLPPSLPLPRSFLLKSLEQVRKIQARNTELLEQLCATYKLCHPEELVLFGHSLGIPKASLSSCSSQALQQTKCLSQLHSGLFLYQGLLQALAGISSELAPTLDMLHLDVDNFATTIWQQMESLGVAPTVQPTQSTMPIFTSAFQRRAGGVLVTSYLQSFLETAHHALHHLPRPAQKHFPESLFISI |
Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
Purity : |
> 95% by SDS-PAGE analysis. |
Storage : |
Lyophilized recombinant rat Granulocyte Colony-Stimulating Factor (rrG-CSF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rrG-CSF remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : |
Lyophilized after extensive dialysis against 20mM Citric Acid |
Reconstitution : |
Reconstituted in ddH2O at 100 μg/mL. |