Active Recombinant Rat Csf3 Protein (194 aa)

Cat.No. : Csf3-395C
Product Overview : Recombinant rat Granulocyte Colony-Stimulating Factor (rrG-CSF) produced in E. coli is a single non-glycosylated polypeptide chain containing of 194 amino acids. A fully biologically active molecule, rrG-CSF has a molecular mass of 21.4 kDa analyzed by non-reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Protein Length : 194
Description : Granulocyte Colony-Stimulating Factor (G-CSF) is a hematopoietic cytokine belonging to the four-helix bundle cytokine superfamily. G-CSF is produced by monocytes, macrophages, fibroblasts, and endothelial cells. Its expression is highly regulated and induced by a variety of agents, including Tumor Necrosis Factor (TNF), Interleukin-1 (IL-1), Interferon γ (IFN-γ), and Granulocyte-Macrophage Colony-Stimulating Factor (GM-CSF). G-CSF binds to the CSF-specific high affinity receptors expressed on neutrophilic granulocyte lineage. In vivo G-CSF regulates the production of neutrophilic granulocytes, a critical part of host defense systems, and helps the maturation of leukemic cell lines. G-CSF is widely employed clinically because of its fairly innocuous safety profile.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 0.1 ng/mL, measured by a cell proliferation assay using NSF-60 cells, corresponding to a specific activity of > 1 × 10^7 units/mg.
Molecular Mass : 21.4 kDa, observed by non-reducing SDS-PAGE.
AA Sequence : MIPLLTVSSLPPSLPLPRSFLLKSLEQVRKIQARNTELLEQLCATYKLCHPEELVLFGHSLGIPKASLSSCSSQALQQTKCLSQLHSGLFLYQGLLQALAGISSELAPTLDMLHLDVDNFATTIWQQMESLGVAPTVQPTQSTMPIFTSAFQRRAGGVLVTSYLQSFLETAHHALHHLPRPAQKHFPESLFISI
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% by SDS-PAGE analysis.
Storage : Lyophilized recombinant rat Granulocyte Colony-Stimulating Factor (rrG-CSF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rrG-CSF remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against 20mM Citric Acid
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name Csf3 colony stimulating factor 3 (granulocyte) [ Rattus norvegicus ]
Official Symbol Csf3
Synonyms CSF3; colony stimulating factor 3 (granulocyte); granulocyte colony-stimulating factor;
Gene ID 25610
mRNA Refseq NM_017104
Protein Refseq NP_058800

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Csf3 Products

Required fields are marked with *

My Review for All Csf3 Products

Required fields are marked with *

0
cart-icon