Recombinant Rhesus CSF3 protein
Cat.No. : | CSF3-387R |
Product Overview : | Recombinant Rhesus CSF3 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhesus macaque |
Source : | E.coli |
Tag : | Non |
Protein Length : | 174 |
Description : | The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes. The active protein is found extracellularly. Alternatively spliced transcript variants have been described for this gene. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine NFS-60 cells is less than 0.05 ng/ml, corresponding to a specific activity of > 2.0 × 10⁷ IU/mg. |
Molecular Mass : | Approximately 18.9 kDa, a single non-glycosylated polypeptide chain containing 174 amino acids. |
AA Sequence : | TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLRHSLGIPWAPLSSCPSQALQLTGCLSQLHSSLFLYQGLLQALEGISPELSPTLDTLQLDIADFATTIWQQMEDLGMAPALQPTQGAMPAFTSAFQRRAGGVLVASHLQRFLELAYRVLRHLAQS |
Endotoxin : | Less than 0.1 EU/μg of rRhG-CSF as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | CSF3 |
Official Symbol | CSF3 |
Gene ID | 698961 |
mRNA Refseq | XM_001095097.4 |
Protein Refseq | XP_001095097.2 |
UniProt ID | F7H1Q6 |
◆ Recombinant Proteins | ||
CSF3-777P | Recombinant Pig CSF3 protein, His-tagged | +Inquiry |
CSF3-26467TH | Recombinant Human CSF3 | +Inquiry |
CSF3-4407C | Recombinant Chicken CSF3 Protein | +Inquiry |
CSF3-2162H | Recombinant Human CSF3 Protein, His-tagged | +Inquiry |
CSF3-1973H | Recombinant Human CSF3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF3-2948HCL | Recombinant Human CSF3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CSF3 Products
Required fields are marked with *
My Review for All CSF3 Products
Required fields are marked with *
0
Inquiry Basket