"TGFB2" Related Products

Expand

Recombinant Human Transforming Growth Factor, Beta 2, His-tagged

Cat. No.: TGFB2-633H
Product Overview: Recombinant human TGFB2, fused to His tag at N-terminus, was expressed in Nicotiana benthamiana and purified by using conventional chromatography techniques.
Description: The three mammalian isoforms of TGF beta, TGF beta1, beta2, beta3, signal through the same receptor and elicit similar biological responses. They are multifunctional cytokines that regulate cell proliferation, growth, differentiation and motility as well as synthesis and deposition of the extracellular matrix. They are involved in various physiological processes including embryogenesis, tissue remodeling and wound healing. They are secreted predominantly as latent complexes which are stored at the cell surface and in the extracellular matrix. The release of biologically active TGF beta isoform from a latent complex involves proteolytic processing of the complex and /or induction of conformational changes by proteins such as thrombospondin-1.
Concentration: 50 ng/ul
Source: Human
Host: Nicotiana benthamiana
Form: Lyophilized from 50mM Tris HCl at pH 7.4.
Method of Purification: Sequential chromatography (FPLC)
Purity: >97 % by SDS - PAGE gel
Sequence: HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
Molecular Mass: 13.5 kDa single chain containing 118 amino residues
Applications: Numerous applications are possible with this product and should be tested by the end user under their own laboratory conditions
Contaminants: Free from animal matter
Endotoxin Levels: <0.04 EU/ug protein (LAL method)
Storage: Aliquot and store at -20 deg C. Avoid repeated freeze/thaw Cycles
Gene Name: TGFB2 transforming growth factor, beta 2 [ Homo sapiens ]
Official Symbol: TGFB2
Synonyms: MGC116892; TGF-beta2; TGFB2; Transforming growth factor beta-2; TGF-beta-2; Glioblastoma-derived T-cell suppressor factor; G-TSF; BSC-1 cell growth inhibitor; Polyergin; Cetermin; transforming growth factor, beta 2
Gene ID: 7042
mRNA Refseq: NM_001135599
Protein Refseq: NP_001129071
MIM: 190220
UniProt ID: P61812
Chromosome Location: 1q41
Pathway: ATF-2 transcription factor network; Amoebiasis; Cell cycle; Chagas disease (American trypanosomiasis); Chronic myeloid leukemia; Colorectal cancer; Cytokine-cytokine receptor interaction; Dilated cardiomyopathy; Endochondral Ossification; Endocytosis; Formation of Platelet plug; HTLV-I infection; Hemostasis; Hypertrophic cardiomyopathy (HCM); Leishmaniasis; MAPK signaling pathway; Malaria; Osteoclast differentiation; Pancreatic cancer; Platelet Activation; Platelet degranulation; Regulation of retinoblastoma protein
Function: beta-amyloid binding; cytokine activity; growth factor activity; protein binding; contributes_to protein binding; protein heterodimerization activity; protein homodimerization activity; receptor binding; receptor signaling protein serine/threonine kinase activity; transforming growth factor beta receptor binding; type II transforming growth factor beta receptor binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.