Recombinant Human DPP4, His tagged DPP4-8313H

Recombinant Human DPP4, His tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human DPP4, His tagged

Recombinant Human DPP4, His tagged

DPP4 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : DPP4-8313H
Product Overview : DPPIV Human Recombinant produced in High-5 cells is a single, glycosylated polypeptide chain containing 746 amino acids (39-766) and having a molecular mass of 86.4 kDa.DPPIV is fused to His Tag at C-terminus and purified using conventional chromatography techniques.
Description : The protein encoded by this gene is identical to adenosine deaminase complexing protein-2, and to the T-cell activation antigen CD26. It is an intrinsic membrane glycoprotein and a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides.
Source : High-5 cells
Species : Human
Tag : His
Form : DPP4 is formulated in 20 mM Tris-HCl buffer pH-8, 100mM NaCl, 1mM EDTA and 10% glycerol.
Bio-activity : >20 Units/mg.
AA Sequence : ADP-SRKTYTLTDYLKNTYRLKLYSLRWISDHEYLYKQENNILVFNAEYGNSSVFLENSTFDEFGHSINDYSISP DGQFILLEYNYVKQWRHSYTASYDIYDLNKRQLITEERIPNNTQWVTWSPVGHKLAYVWNNDIYVKIEPNLPSYR ITWTGKEDIIYNGITDWVYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVPLIEYSFYSDESLQYPKTVRVPYPKA GAVNPTVKFFVVNTDSLSSVTNATSIQITAPASMLIGDHYLCDVTWATQERISLQWLRRIQNYSVMDICDYDESS GRWNCLVARQHIEMSTTGWVGRFRPSEPHFTLDGNSFYKIISNEEGYRHICYFQIDKKDCTFITKGTWEVIGIEA LTSDYLYYISNEYKGMPGGRNLYKIQLSDYTKVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLYTLHS SVNDKGLRVLEDNSALDKMLQNVQMPSKKLDFIILNETKFWYQMILPPHFDKSKKYPLLLDVYAGPCSQKADTVF RLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGTFEVEDQIEAARQFSKMGFVDNKRIAIWGWSYGGY VTSMVLGSGSGVFKCGIAVAPVSRWEYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADD NVHFQQSAQISKALVDVGVDFQAMWYTDEDHGIASSTAHQHIYTHMSHFIKQCFSLP-SGRLVPRGSHHHHHH.
Purity : Greater than 95.0% as determined by Analysis by SDS-PAGE.On SDS-PAGE under denatured condition, apparent molecular weight of glycosylated DPP4 will migrate at approximately 90kDa.
Applications : Unit Definition One unit will hydrolyze mmole of p-nitroaniline per minute at pH8.0 at 37℃ using 1mM of Gly-Pro p-nitroanilde as substrate.
Notes : For research use only.
Storage : DPP4 although stable 4 ℃ for weeks, should be stored desiccated below -18 ℃. For long term storage it is recommended to add carrier protein (0. 1% HSA or BSA). Please prevent freeze/thaw cycles.
Gene Name : DPP4 dipeptidyl-peptidase 4 [ Homo sapiens ]
Official Symbol : DPP4
Synonyms : DPP4; dipeptidyl-peptidase 4; ADCP2, adenosine deaminase complexing protein 2 , CD26, dipeptidylpeptidase IV (CD26, adenosine deaminase complexing protein 2); dipeptidyl peptidase 4; DPPIV; ADCP-2; DPP IV; dipeptidylpeptidase 4; dipeptidyl peptidase IV; T-cell activation antigen CD26; adenosine deaminase complexing protein 2; dipeptidylpeptidase IV (CD26, adenosine deaminase complexing protein 2); CD26; ADABP; ADCP2; TP103;
Gene ID : 1803
mRNA Refseq : NM_001935
Protein Refseq : NP_001926
MIM : 102720
UniProt ID : P27487
Chromosome Location : 2q23-qter
Pathway : Incretin Synthesis, Secretion, and Inactivation, organism-specific biosystem; Integration of energy metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem; Protein digestion and absorption, organism-specific biosystem; Protein digestion and absorption, conserved biosystem; Regulation of Insulin Secretion, organism-specific biosystem; Synthesis, Secretion, and Inactivation of Glucagon-like Peptide-1 (GLP-1), organism-specific biosystem;
Function : aminopeptidase activity; collagen binding; dipeptidyl-peptidase activity; peptidase activity; peptide binding; protease binding; protein binding; protein homodimerization activity; receptor activity; receptor binding; serine-type endopeptidase activity; serine-type peptidase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy