Recombinant Human APOA4, His-tagged

Cat.No. : APOA4-30H
Product Overview : Recombinant Human Apolipoprotein A4/APOA4 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Glu21-Ser396) of Human APOA4 fused with a 6His tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 21-396 a.a.
Description : Apolipoprotein A4 (APOA4) is a secreted protein that belongs to the apolipoprotein A1/A4/E family. Apoa-IV is a major component of HDL and chylomicrons. APOA4 is secreted into circulation on the surface of newly synthesized chylomicron particles. APOA4 play a role in the regulation of appetite and satiety in rodent models. APOA4 involved in chylomicrons and VLDL secretion and catabolism and required for efficient activation of lipoprotein lipase by ApoC-II. In addition, APOA4 is a potent activator of lecithin-cholesterol acyltransferase in vitro.
Form : Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
AA Sequence : EVSADQVATVMWDYFSQLSNNAKEAVEHLQKSELTQQLNALFQDKLGEVNTYAGDLQKKLVPFAT ELHERLAKDSEKLKEEIGKELEELRARLLPHANEVSQKIGDNLRELQQRLEPYADQLRTQVNTQA EQLRRQLTPYAQRMERVLRENADSLQASLRPHADELKAKIDQNVEELKGRLTPYADEFKVKIDQT VEELRRSLAPYAQDTQEKLNHQLEGLTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRG NTEGLQKSLAELGGHLDQQVEEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEK DLRDKVNSFFSTFKEKESQDKTLSLPELEQQQEQQQEQQQEQVQMLAPLESVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name APOA4 apolipoprotein A-IV [ Homo sapiens ]
Official Symbol APOA4
Synonyms APOA4; apolipoprotein A-IV; apo-AIV; apoA-IV; apolipoprotein A4; MGC142154; MGC142156;
Gene ID 337
mRNA Refseq NM_000482
Protein Refseq NP_000473
MIM 107690
UniProt ID P06727
Chromosome Location 11q23-qter
Pathway Amyloids, organism-specific biosystem; Chylomicron-mediated lipid transport, organism-specific biosystem; Disease, organism-specific biosystem; Fat digestion and absorption, organism-specific biosystem; Fat digestion and absorption, conserved biosystem; Lipid digestion, mobilization, and transport, organism-specific biosystem; Lipoprotein metabolism, organism-specific biosystem;
Function antioxidant activity; cholesterol transporter activity; copper ion binding; contributes_to eukaryotic cell surface binding; lipid binding; lipid transporter activity; phosphatidylcholine binding; phosphatidylcholine-sterol O-acyltransferase activator activity; protein homodimerization activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All APOA4 Products

Required fields are marked with *

My Review for All APOA4 Products

Required fields are marked with *

0
cart-icon