Recombinant Human APOA4, His-tagged APOA4-30H

Recombinant Human APOA4, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human APOA4, His-tagged

Recombinant Human APOA4, His-tagged

APOA4 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : APOA4-30H
Product Overview : Recombinant Human Apolipoprotein A4/APOA4 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Glu21-Ser396) of Human APOA4 fused with a 6His tag at the C-terminus.
Description : Apolipoprotein A4 (APOA4) is a secreted protein that belongs to the apolipoprotein A1/A4/E family. Apoa-IV is a major component of HDL and chylomicrons. APOA4 is secreted into circulation on the surface of newly synthesized chylomicron particles. APOA4 play a role in the regulation of appetite and satiety in rodent models. APOA4 involved in chylomicrons and VLDL secretion and catabolism and required for efficient activation of lipoprotein lipase by ApoC-II. In addition, APOA4 is a potent activator of lecithin-cholesterol acyltransferase in vitro.
Source : HEK293
Species : Human
Tag : His
Form : Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
AA Sequence : EVSADQVATVMWDYFSQLSNNAKEAVEHLQKSELTQQLNALFQDKLGEVNTYAGDLQKKLVPFAT ELHERLAKDSEKLKEEIGKELEELRARLLPHANEVSQKIGDNLRELQQRLEPYADQLRTQVNTQA EQLRRQLTPYAQRMERVLRENADSLQASLRPHADELKAKIDQNVEELKGRLTPYADEFKVKIDQT VEELRRSLAPYAQDTQEKLNHQLEGLTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRG NTEGLQKSLAELGGHLDQQVEEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEK DLRDKVNSFFSTFKEKESQDKTLSLPELEQQQEQQQEQQQEQVQMLAPLESVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name : APOA4 apolipoprotein A-IV [ Homo sapiens ]
Official Symbol : APOA4
Synonyms : APOA4; apolipoprotein A-IV; apo-AIV; apoA-IV; apolipoprotein A4; MGC142154; MGC142156;
Gene ID : 337
mRNA Refseq : NM_000482
Protein Refseq : NP_000473
MIM : 107690
UniProt ID : P06727
Chromosome Location : 11q23-qter
Pathway : Amyloids, organism-specific biosystem; Chylomicron-mediated lipid transport, organism-specific biosystem; Disease, organism-specific biosystem; Fat digestion and absorption, organism-specific biosystem; Fat digestion and absorption, conserved biosystem; Lipid digestion, mobilization, and transport, organism-specific biosystem; Lipoprotein metabolism, organism-specific biosystem;
Function : antioxidant activity; cholesterol transporter activity; copper ion binding; contributes_to eukaryotic cell surface binding; lipid binding; lipid transporter activity; phosphatidylcholine binding; phosphatidylcholine-sterol O-acyltransferase activator activity; protein homodimerization activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy